Align D-gluconate TRAP transporter, large permease component (characterized)
to candidate GFF762 PGA1_c07760 TRAP transporter, subunit DctM
Query= reanno::psRCH2:GFF2081 (425 letters) >FitnessBrowser__Phaeo:GFF762 Length = 442 Score = 197 bits (500), Expect = 7e-55 Identities = 124/425 (29%), Positives = 217/425 (51%), Gaps = 9/425 (2%) Query: 1 MTVVVFLSSLLGFMTLGMPIAFALLLTGSVLMWYLDFWDVQLLAQNLQAGADSFPLLAVP 60 + V++F++ + L +P+ A+ ++ + + ++L G D+F L AVP Sbjct: 18 LPVILFVA----LIALAVPVWAAIGAAAITMLVMSGDLPLSAIGESLFTGIDAFALTAVP 73 Query: 61 FFILAGELMNAGGISRRIIAMAQAYFGHKRGGLGYVAIAASVLLASMSGSALADTAALAT 120 FIL G+++ G+S++ + +A+A RGG G + + A++SGS A AA+ Sbjct: 74 LFILTGDVLVRTGLSKKFLDVAEALTCWTRGGFGSATVLVCGMFAAISGSDAAGAAAVGR 133 Query: 121 LLLPMMRERGYPLSSSSGLVAAGGIIAPIIPPSMPFVIYGVVTGTSISQLFLAGMVPGLI 180 + + + E GYP + LVAAG +IPPS+ ++I G+V G S S LFLA ++PG+ Sbjct: 134 MTIARLVESGYPRPYACALVAAGACTGILIPPSIAYIIIGLVLGISASTLFLAALIPGIA 193 Query: 181 MGMGLIVAWTLIARRIDEPKQEKASAAE----RRRVLVDGAAALMLPVIIVGGLRGGLFT 236 + + ++V ++ R E + L G A ++P II G+ G T Sbjct: 194 ILVSILVTNIIMNRLYTYETGGNMGLGEWLGNLGQSLKSGWYAFIVPGIIFYGIFSGRLT 253 Query: 237 PTEAAVVAAVYALAVSTLLYRELNWAGLVEVLTRASRTTASVMFLCAAATVSAYMITLAQ 296 PTEA A V + + LL L A +L +++ ++ + A + A + + Sbjct: 254 PTEAGATAVVVTILMGFLL-GTLKLADFPAMLVSSAKVNGVILPIIAFSAPLAEALAIMG 312 Query: 297 LPDEIAAMLGPLAQDPKLLMVAIMLLMIAVGMVLDLTPTILILGPVLAPIAIKAGIDPVY 356 +P + L DP +L++ ++ ++IA G V++ TP I+IL P+L P+A G++ + Sbjct: 313 VPQGFVTAVTGLTDDPSILILLMICILIAAGCVMETTPNIVILAPILKPLADNIGMNEIQ 372 Query: 357 FGVMFVLIGSIGLITPPVGTVLNVVGGIGRLRMETLVRGVMPFFLIYLVIVGLLIAVPSI 416 F +M + +G ITPP+G L VV GI + + +PF L L++V L+ +P+I Sbjct: 373 FCIMMITALGVGFITPPLGLNLFVVSGITGESILKIAARAIPFVLTMLIVVLLIAYLPAI 432 Query: 417 ITVPL 421 T L Sbjct: 433 STTLL 437 Lambda K H 0.328 0.142 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 480 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 442 Length adjustment: 32 Effective length of query: 393 Effective length of database: 410 Effective search space: 161130 Effective search space used: 161130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory