Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate GFF197 PGA1_c02010 glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD
Query= reanno::pseudo6_N2E2:Pf6N2E2_2050 (263 letters) >FitnessBrowser__Phaeo:GFF197 Length = 263 Score = 232 bits (591), Expect = 7e-66 Identities = 121/245 (49%), Positives = 165/245 (67%), Gaps = 10/245 (4%) Query: 14 LDIRGLRKQYGPLEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQIMLD 73 ++I + K YG VL+ ++L++ +G + + G SGSGK+TL+RC+N LEE Q G IM+D Sbjct: 23 IEINNMNKWYGSFHVLRDINLTVNQGERIVIAGPSGSGKSTLIRCLNALEEHQQGNIMVD 82 Query: 74 GESIGYDDIDGKRVRHPEKVIARHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLPKD 133 G + D K I + R+ GM FQ FNLFPHLT L+N TL + V+K PK Sbjct: 83 GTELSND----------LKNIDKIRSEVGMVFQHFNLFPHLTILENCTLAPIWVRKTPKK 132 Query: 134 EAVALAEKWLERVGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDPEL 193 EA A +LE+V + ++ +PG LSGGQQQRVAIAR++ M P +MLFDE TSALDPE+ Sbjct: 133 EAEERAMHFLEKVKIPDQAHKYPGMLSGGQQQRVAIARSLCMMPRIMLFDEPTSALDPEM 192 Query: 194 VGEVLNVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQSPR 253 + EVL+ + LAE+GMTML VTHEM FA +V+++++FM+ G+I EQ P+E F PQS R Sbjct: 193 IKEVLDTMIELAEEGMTMLCVTHEMGFARQVANRVIFMDAGQIVEQNEPEEFFNNPQSER 252 Query: 254 LAEFL 258 FL Sbjct: 253 TKLFL 257 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 263 Length adjustment: 25 Effective length of query: 238 Effective length of database: 238 Effective search space: 56644 Effective search space used: 56644 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory