Align ABC transporter for D-Glucosamine, permease component 1 (characterized)
to candidate GFF1646 PGA1_c16690 binding protein-dependent transport system, inner membrane component
Query= reanno::Smeli:SM_b21219 (281 letters) >FitnessBrowser__Phaeo:GFF1646 Length = 283 Score = 145 bits (365), Expect = 1e-39 Identities = 88/260 (33%), Positives = 133/260 (51%), Gaps = 8/260 (3%) Query: 24 LAPVAWLLIMSISPAADLSAKPLAWWPSDIDLSRYRTLLSAVENSAGAAFIASLLNSIKV 83 L P+ WL+ ++I+P A + ++ PS + + T+L E F+A NS+ V Sbjct: 30 LFPLYWLMKIAITPDALIFSEGTRMLPSAVTFENFATVLFETE------FLAYFRNSLTV 83 Query: 84 AGMATLAAVVVAVPAAWAVSRTPAVAWSLY--AVIATYMLPPVALAVPLYMGLAYFGLLN 141 + ++A A +A SR + ++ T M P + + P+Y +A GLLN Sbjct: 84 SLGTAFFTTLIAAGAGYAFSRFVFAGKRIIIAVMLITQMFPLLMIIAPIYKIVADLGLLN 143 Query: 142 SVFGLALVYLTILAPFTTWLLKSGFDSIPREIESAAMIDGARLDQILRILTLPLAAPVMA 201 S+ L +VY PF T+L++S FD IP+++E AAM+DG Q LR + PL P + Sbjct: 144 SLTSLIVVYTAFNIPFATFLMQSFFDGIPKDLEEAAMMDGCSRFQALRTVVFPLTLPGLG 203 Query: 202 TSALFAFLLAWDEFFYALLFTSDQRAKTLTVAIADLAGGRVSDYGLIATAGVLAALPPVL 261 + F F AW E +AL+ S A T V + D+G + AGVLA +P L Sbjct: 204 ATLGFVFTAAWSELLFALMLISKNDAMTFPVGLLTFVSKFSVDWGQMMAAGVLALVPSCL 263 Query: 262 IGLIMQRALISGLTSGGVKG 281 + +QR L+ GLTSG VKG Sbjct: 264 FFIFIQRYLVQGLTSGAVKG 283 Score = 23.1 bits (48), Expect = 0.007 Identities = 10/18 (55%), Positives = 13/18 (72%) Query: 103 SRTPAVAWSLYAVIATYM 120 SR PA+A+ YA IA Y+ Sbjct: 9 SRHPALAFGKYAAIAFYL 26 Lambda K H 0.325 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 281 Length of database: 283 Length adjustment: 26 Effective length of query: 255 Effective length of database: 257 Effective search space: 65535 Effective search space used: 65535 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory