Align ABC transporter for D-Glucosamine, permease component 2 (characterized)
to candidate GFF1647 PGA1_c16700 binding protein-dependent transport system, inner membrane component
Query= reanno::Smeli:SM_b21220 (293 letters) >FitnessBrowser__Phaeo:GFF1647 Length = 316 Score = 167 bits (422), Expect = 4e-46 Identities = 98/277 (35%), Positives = 160/277 (57%), Gaps = 5/277 (1%) Query: 11 WLLMLPLLVVMTAVIGWPLVDTVRLSFTDAKLVGTEG-GFVGTANYIKMLGGSNFQRALV 69 +L + P+++++ +V+ PL+ + SF +L+ G+VG NY K+ F AL Sbjct: 34 FLYLSPMILLIGSVMLIPLIVGISYSFQSIELLNPFATGWVGFENYEKLWSDRKFWIALE 93 Query: 70 TTTWFAVISVAAEMVLGVLAALLLNQQFRGRTALRALMILPWALPTVVNATLWRLIYNPE 129 T ++ S+ + LG+ A+LLN QF G+ +AL+ LPWA+PT ++A W ++NP Sbjct: 94 NTFFWTFWSIFFQFFLGLGLAMLLNTQFFGKKLFQALVFLPWAVPTFLSALTWAWLFNPV 153 Query: 130 YGALNAALTQLGLLDSYRSWLGEPGTALAALIVADCWKNFPLVALIALAALQAVPRDITA 189 G + L LG+L + LG+P A+ I A+ W P A+ LAALQ++P ++ Sbjct: 154 IGPIPHWLAALGVLSEPYNILGDPDLAIWGPITANIWFGVPFFAITLLAALQSIPGELYE 213 Query: 190 ASLVDGAGPFNRFRFVIMPYLAGPLLVALVLRTIEAFKVFDIIWVMTRGGPANSTRTLSI 249 A+ +DGA P+ F + +P+LA + + ++LRTI D+I+VMT GGPANST+ LS Sbjct: 214 AAEIDGATPWQSFTKITLPFLAPMIAITVMLRTIWIANFADLIFVMTGGGPANSTQILST 273 Query: 250 LVYQEAFSFQRAGSGASLALIVTLLVTILAAAYAALL 286 ++ A F++ G + + V LL+ +L AYA +L Sbjct: 274 YIFTTA--FRKLDFGYASTIAVALLIILL--AYAVIL 306 Lambda K H 0.326 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 316 Length adjustment: 27 Effective length of query: 266 Effective length of database: 289 Effective search space: 76874 Effective search space used: 76874 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory