Align N-Acetyl-D-glucosamine ABC transport system, permease component 1 (characterized)
to candidate GFF1647 PGA1_c16700 binding protein-dependent transport system, inner membrane component
Query= reanno::Phaeo:GFF2751 (308 letters) >FitnessBrowser__Phaeo:GFF1647 Length = 316 Score = 115 bits (289), Expect = 1e-30 Identities = 93/295 (31%), Positives = 149/295 (50%), Gaps = 23/295 (7%) Query: 16 VFLAPAVLVYTAIMIFPLFNTLRLALYSESDQIRQF----VGLANFETLFGNPNWSEQ-F 70 ++L+P +L+ ++M+ PL + + S + + F VG N+E L WS++ F Sbjct: 35 LYLSPMILLIGSVMLIPLIVGISYSFQS-IELLNPFATGWVGFENYEKL-----WSDRKF 88 Query: 71 WNALGNNFWFFFVHMLVQNPIGVALAAILSHPRLRFAALYRTAIFVPTILSFVIVGFAWK 130 W AL N F++ F + Q +G+ LA +L+ + L++ +F+P + + W Sbjct: 89 WIALENTFFWTFWSIFFQFFLGLGLAMLLN-TQFFGKKLFQALVFLPWAVPTFLSALTWA 147 Query: 131 LILSPIWGITPDLLDAIGLKWLFAPW--LGKEDYALTTLALISVWQFVGIPMMLIYAALL 188 + +P+ G P L A+G+ L P+ LG D A+ ++W V + + AAL Sbjct: 148 WLFNPVIGPIPHWLAALGV--LSEPYNILGDPDLAIWGPITANIWFGVPFFAITLLAALQ 205 Query: 189 SIPEEVIEAGEVDGITGMSAFWKIKLPLILPSIGIISILTFVGNFNAFDLIYTTQGALAG 248 SIP E+ EA E+DG T +F KI LP + P I I +L + N DLI+ G G Sbjct: 206 SIPGELYEAAEIDGATPWQSFTKITLPFLAPMIAITVMLRTIWIANFADLIFVMTG--GG 263 Query: 249 PDFSTDILGTFMYRTFFGFQLQLGDPHMGSAIATAMFAIILIGVCIYLFGIQTRL 303 P ST IL T+++ T F +L G S IA A+ IIL+ + L ++ RL Sbjct: 264 PANSTQILSTYIFTTAFR-KLDFG---YASTIAVALL-IILLAYAVILLWMRKRL 313 Lambda K H 0.331 0.145 0.468 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 316 Length adjustment: 27 Effective length of query: 281 Effective length of database: 289 Effective search space: 81209 Effective search space used: 81209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory