GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagF in Phaeobacter inhibens BS107

Align N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) (characterized)
to candidate GFF2318 PGA1_c23500 phosphoenolpyruvate-protein phosphotransferase PtsP

Query= reanno::BFirm:BPHYT_RS02740
         (854 letters)



>lcl|FitnessBrowser__Phaeo:GFF2318 PGA1_c23500
           phosphoenolpyruvate-protein phosphotransferase PtsP
          Length = 746

 Score =  226 bits (575), Expect = 5e-63
 Identities = 157/513 (30%), Positives = 242/513 (47%), Gaps = 8/513 (1%)

Query: 328 ESRLLDKAIATVDADLDTTVRDASQRGAVGEAGIFSVHRVLLEDPTLLDAARDLISLGKS 387
           E   L +A+  +   +D  + + +Q G   +  +   +R+       +    + I  G S
Sbjct: 217 ELERLHEAVEELRVGVDKML-EVTQTGDKEQLQVLEAYRMFANSKGWMRRMEEDIGRGLS 275

Query: 388 AGFAWREAIRAQIAILTNIEDALLAERAADLRDIEKRVLRAL-GYTSATARTLPEEAVLA 446
           A  A  +      A +  ++DA L ER +DL D+  R+LR L G  S T   LPE+ VL 
Sbjct: 276 AEAAVEKEQSQARARMGQVQDAYLRERLSDLDDLSNRLLRILTGQGSETGAELPEDPVLI 335

Query: 447 AEEFTPSDLSTLDRSRVTALVMARGGATSHAAILARQAGIPALVAVGDALHAIPEGTQVV 506
           A    P +L    R+ +  +V+  G   SHAAI+AR   IP +V           G  ++
Sbjct: 336 ARNIGPGELLEYGRN-LRGIVLEEGSVGSHAAIIARALAIPLVVHTKRITTEALNGDHIM 394

Query: 507 VNATTGRLEFAPTELDVERARLERTRLADVREANRRTSQQAAVTSDGRAIEVAANIATLD 566
           V+   G +   P +  V   R +    A  +E       + A+T DGR + +  N   + 
Sbjct: 395 VDGEQGVVHLRPDDTVVSAFRDKIAMQAKAQERYASIRDKQALTRDGRRVHLLMNAGLMA 454

Query: 567 DAKTAVENGADSVGLLRTELLFIHRAAAPTTDEHRQSYQAIVDALSGRTAIIRTLDVGAD 626
           D  +   +GA+ VGL RTEL F+ R   P   E    YQ ++DA  G+  + RTLD+G+D
Sbjct: 455 DLPSLENSGAEGVGLFRTELQFLVRNQMPKRSELVALYQRVLDAAGGKRVVFRTLDIGSD 514

Query: 627 KEVDYLTLPPEPNPALGLRGIRLAQVRPDLLDDQLRGLLAVQPLGAVRILLPMVTDVGEL 686
           K + Y+    EPNPALG R IR+   +P ++  QL+ L+       + ++ P V    E 
Sbjct: 515 KVLPYMKPTDEPNPALGWRAIRVGLDKPGVMRMQLQALIRAANGRPLTVMFPFVAQFEEF 574

Query: 687 IRIRKRID---EFARELGRT--EPIEVGVMIEVPSAALLADQLAQHADFLSIGTNDLTQY 741
              +  ++   E  R LG    E +EVG M+E PS A    +     +FLSIG NDL Q+
Sbjct: 575 RDAKAEVEKTLERERRLGHALPEKLEVGAMLETPSLAFAPQKFFDEVEFLSIGGNDLKQF 634

Query: 742 TLAMDRCQADLAAQADGLHPAVLRLIAATVQGADKHGKWVGVCGALAGDPLAMPLLVGLG 801
             A DR    +  + D L+ + L  IA  V+  +K G  +  CG  AG P+    L  +G
Sbjct: 635 FFAADRENERVRKRYDTLNVSYLSFIAQIVERCEKSGTPLSFCGEDAGRPIEAVCLAAMG 694

Query: 802 VTELSVDPVSVPGIKARVRNLDYQLCRQRAQDA 834
           +  LS+ P SV  +K+ +  +D    R+   DA
Sbjct: 695 LRVLSMRPASVGPVKSLLMRVDLNDIRKIIADA 727


Lambda     K      H
   0.317    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1210
Number of extensions: 58
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 854
Length of database: 746
Length adjustment: 41
Effective length of query: 813
Effective length of database: 705
Effective search space:   573165
Effective search space used:   573165
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory