Align NgcF, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate GFF726 PGA1_c07410 binding protein dependent transport system permease
Query= TCDB::Q8RJU9 (308 letters) >FitnessBrowser__Phaeo:GFF726 Length = 315 Score = 135 bits (341), Expect = 1e-36 Identities = 92/286 (32%), Positives = 149/286 (52%), Gaps = 22/286 (7%) Query: 12 FLAVPLGLYALLVVWPFIQSIYYSFTDWTGLSPDFKTVGFDNYERMLDDDIFWKSLQHSL 71 FLA + + V++P +QS SF W GL D + +G +NY ++DD F SL ++L Sbjct: 36 FLAPGVIFFLFYVIFPILQSFNLSFYRWDGLG-DPQFIGMENYRELMDDRAFEVSLWNNL 94 Query: 72 LFALLLPVVTIGLALFFAFMINVGGRRRRGGPVITGVRGSGFYKIVYFFPQVLSIAIVAL 131 + LLL ++ I LF A +N +TG+R YK ++FFP V+S +V L Sbjct: 95 KW-LLLYLLAIPAGLFIALFLN---------QTVTGIR---LYKSLFFFPFVISQVVVGL 141 Query: 132 LFAFAYNPDSGAINSLLRGIGLGDVQPVWLGDPDLALWCVMAVIVWSTVGFFVVLFSAGM 191 +F++ Y+P G +N +L +GLG + LGDP L + ++ +W + ++L+ G+ Sbjct: 142 VFSWFYDPTFGLLNQVLAWVGLGPINV--LGDPTLVTYGIIIAGLWPQTAYCMILYLTGL 199 Query: 192 ASIPADIYEAALLDGANRVTTFFRITLPLLWDTVQSGWVYMGILALGAESFAVVHIMTTG 251 ++ + EAA LDGA + + +P L +V I AL SF ++ IMT Sbjct: 200 NAVDPEQVEAARLDGAKGAKMLWYVIIPQLRPATFVAFVVTIIGAL--RSFDLISIMTN- 256 Query: 252 PGGPDYSTTVMVLYVYQKAFRD--GQAAYATTIGVALLIVTLAFAA 295 GGP S+ V+ Y+++KA + + Y I V L ++ L F A Sbjct: 257 -GGPFGSSRVLSFYMFEKALSEYGFRMGYGAAIAVVLFLIMLCFIA 301 Lambda K H 0.330 0.145 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 315 Length adjustment: 27 Effective length of query: 281 Effective length of database: 288 Effective search space: 80928 Effective search space used: 80928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory