Align NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate GFF725 PGA1_c07400 binding protein dependent transport system permease
Query= TCDB::Q8RJU8 (307 letters) >FitnessBrowser__Phaeo:GFF725 Length = 282 Score = 151 bits (382), Expect = 1e-41 Identities = 87/286 (30%), Positives = 146/286 (51%), Gaps = 9/286 (3%) Query: 25 PAPPQKEKKEG-TVLNVFSHGILVLWAFMVVLPLLWAVMTSFKDDASIF-GSPWSLPDKL 82 P P Q + T LV+W +LPL+ + S K +A G+ W +P Sbjct: 3 PKPIQNSSRAWQTTYQALVPAALVMW----LLPLIAVAIFSIKPEADFTTGNYWGVPSSF 58 Query: 83 H-FDNWSRAWTEAHMGDYFLNTVLVVGGSLIGTLVLGSMAAYVLARFDFPGNRFIYYLFI 141 N+ R + + M Y LN+VL+ ++IG + L M + L + F GN ++++F+ Sbjct: 59 EGLSNYGRVFFGSDMPRYLLNSVLITVPTVIGAVALSCMTGFALGVYKFRGNLLLFFMFV 118 Query: 142 GGMSFPIMLALVPLFYVVNNMGLLNTLHGLILVYIAYSLPFTVFFLTAFFRTLPSSVAEA 201 G P + +VP+ + +MGL NT GL+L +IA+ F F+ F R LP + EA Sbjct: 119 AGNFVPFQILMVPVRDLTLDMGLYNTKTGLVLFHIAFQTGFCTLFMRNFIRALPFELIEA 178 Query: 202 AFVDGASHTRTFFQIMLPMAKPGLISVGIFNFLGQWNQYMLPTVLNTDPDKRVLTQGLVQ 261 A V+G + R F+ ++LP+ KP + ++ + F WN Y VL + + +T G+ Sbjct: 179 ARVEGVAEWRIFWFVVLPLMKPAIAALSVLIFTFIWNDYFWAVVLTQGAESQPVTAGIT- 237 Query: 262 LAVSQGYKGDWSGLFAGLVMAMLPVLAAYIIFQRQVVQGLTAGALK 307 + + Y+ + + AG ++A LP +A + + QR + GLT GA+K Sbjct: 238 -SFNAQYRAAYHLMSAGSIVAALPPVAMFFLMQRHFIAGLTLGAVK 282 Lambda K H 0.326 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 282 Length adjustment: 26 Effective length of query: 281 Effective length of database: 256 Effective search space: 71936 Effective search space used: 71936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory