Align Putative TRAP dicarboxylate transporter, DctM subunit (characterized, see rationale)
to candidate GFF762 PGA1_c07760 TRAP transporter, subunit DctM
Query= uniprot:Q88NP0 (426 letters) >FitnessBrowser__Phaeo:GFF762 Length = 442 Score = 224 bits (571), Expect = 4e-63 Identities = 131/417 (31%), Positives = 226/417 (54%), Gaps = 8/417 (1%) Query: 10 FIVLILIGMPVAYALGLSALIGAWWI-DIPLQAMMIQVASGVNKFSLLAIPFFVLAGAIM 68 F+ LI + +PV A+G +A+ D+PL A+ + +G++ F+L A+P F+L G ++ Sbjct: 23 FVALIALAVPVWAAIGAAAITMLVMSGDLPLSAIGESLFTGIDAFALTAVPLFILTGDVL 82 Query: 69 AEGGMSRRLVAFAGVLVGFVRGGLSLVNIMASTFFGAISGSSVADTASVGSVLIPEMERK 128 G+S++ + A L + RGG ++ F AISGS A A+VG + I + Sbjct: 83 VRTGLSKKFLDVAEALTCWTRGGFGSATVLVCGMFAAISGSDAAGAAAVGRMTIARLVES 142 Query: 129 GYPREFSTAVTVSGSVQALLTPPSHNSVLYSLAAGGTVSIASLFMAGIMPGLLLSAVMMG 188 GYPR ++ A+ +G+ +L PPS ++ L G +S ++LF+A ++PG+ + ++ Sbjct: 143 GYPRPYACALVAAGACTGILIPPSIAYIIIGLVLG--ISASTLFLAALIPGIAILVSILV 200 Query: 189 LCLIFAKKRNYPKGEVIPLREALKIAGEAL----WGLMAMVIILGGILSGVFTATESAAV 244 +I + Y G + L E L G++L + + II GI SG T TE+ A Sbjct: 201 TNIIMNRLYTYETGGNMGLGEWLGNLGQSLKSGWYAFIVPGIIFYGIFSGRLTPTEAGAT 260 Query: 245 AVVWSFFVTMFIYRDYKWRDLPKLMHRTVRTISIVMILIGFAASFGYVMTLMQIPSKITT 304 AVV + + F+ K D P ++ + + +++ +I F+A + +M +P T Sbjct: 261 AVVVTILMG-FLLGTLKLADFPAMLVSSAKVNGVILPIIAFSAPLAEALAIMGVPQGFVT 319 Query: 305 AFLTLSDNRYVILMCINFMLMLLGTVMDMAPLILILTPILLPVITGIGVDPVHFGMIMLV 364 A L+D+ ++++ + +L+ G VM+ P I+IL PIL P+ IG++ + F ++M+ Sbjct: 320 AVTGLTDDPSILILLMICILIAAGCVMETTPNIVILAPILKPLADNIGMNEIQFCIMMIT 379 Query: 365 NLGIGLITPPVGAVLFVGSAIGKVSIESTVKALMPFYLALFLVLMAVTYIPAISLWL 421 LG+G ITPP+G LFV S I SI +PF L + +V++ + Y+PAIS L Sbjct: 380 ALGVGFITPPLGLNLFVVSGITGESILKIAARAIPFVLTMLIVVLLIAYLPAISTTL 436 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 549 Number of extensions: 38 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 442 Length adjustment: 32 Effective length of query: 394 Effective length of database: 410 Effective search space: 161540 Effective search space used: 161540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory