GapMind for catabolism of small carbon sources

 

Aligments for a candidate for uxuB in Phaeobacter inhibens BS107

Align D-mannonate oxidoreductase; EC 1.1.1.57; Fructuronate reductase (uncharacterized)
to candidate GFF1300 PGA1_c13160 mannitol 2-dehydrogenase MtlK

Query= curated2:P39160
         (486 letters)



>lcl|FitnessBrowser__Phaeo:GFF1300 PGA1_c13160 mannitol
           2-dehydrogenase MtlK
          Length = 488

 Score =  280 bits (716), Expect = 8e-80
 Identities = 172/423 (40%), Positives = 234/423 (55%), Gaps = 8/423 (1%)

Query: 7   SNLP--VARPSWDHSRLESRIVHLGCGAFHRAHQALYTHHLLES-TDSDWGICEVNLMPG 63
           S LP  + RPS+D + +   IVH+G G FHRAHQA Y H L++S    DWGI    +   
Sbjct: 9   SQLPQTIGRPSYDRAEISPGIVHIGLGNFHRAHQAWYLHALMQSGLAMDWGIIGAGVRAA 68

Query: 64  NDRVLIENLKKQQLLYTVAEKGAESTELKIIGSMKEALHPEIDGCEGILNAMARPQTAIV 123
            D  + + L  Q  L T+ E        ++IG + + L  E D    ++  MA     IV
Sbjct: 69  -DAGMRDRLLAQDCLTTLIELDPTGRSAEVIGPLIDFLPVEADNAS-LIRCMAGSPIRIV 126

Query: 124 SLTVTEKGYCADAASGQLDLNNPLIKHDLENPTAPKSAIGYIVEALRLRREKGLKAFTVM 183
           SLTVTE GY  DA    LDLN+  I+HD+  P  P++  G IVEALRLRR +GL AFTV 
Sbjct: 127 SLTVTEGGYYQDAQHKGLDLNHEDIRHDIARPDRPRTVFGAIVEALRLRRGRGLPAFTVQ 186

Query: 184 SCDNVRENGHVAKVAVLGLAQARDPQLAAWIEENVTFPCTMVDRIVPAATPETLQEIADQ 243
           SCDN++ NG + + AV+ LAQ  DP+LAAWI++   FP +MVD IVPA  P  +  +A  
Sbjct: 187 SCDNLQGNGQITRTAVVTLAQQTDPELAAWIDQTGAFPNSMVDCIVPATGPAEI-ALARG 245

Query: 244 LGVYDPCAIACEPFRQWVIEDNFVNGRPDWDKVGAQFVADVVPFEMMKLRMLNGSHSFLA 303
            G+ D   +  E +R WVIED F  GRP WD  GA F  DV  +E MK+R+LN  H  LA
Sbjct: 246 YGIEDTAPVTHENYRHWVIEDEFCAGRPPWDLAGAIFTDDVHGYESMKIRVLNAGHQVLA 305

Query: 304 YLGYLGGYETIADTVTNPAYRKAAFALMMQEQAP-TLSMPEGTDLNAYATLLIERFSNPS 362
             G L    TIAD + +P        +   E  P  +++PE    + Y TL+  RFSNP 
Sbjct: 306 NAGELLSIATIADCMKDPLLAAFFRTVQTAEILPHVIAVPEMAPKD-YLTLIEARFSNPE 364

Query: 363 LRHRTWQIAMDGSQKLPQRLLDPVRLHLQNGGSWRHLALGVAGWMRYTQGVDEQGNAIDV 422
           +R  T ++A DGS + P  ++  +R  +++ G+   L L  A W +   G+ E  + I  
Sbjct: 365 IRDTTRRVAYDGSSRHPGFVMPILRDAVRSKGAIDGLCLVEALWAQMCTGLREDASEIAP 424

Query: 423 VDP 425
            DP
Sbjct: 425 NDP 427


Lambda     K      H
   0.320    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 603
Number of extensions: 20
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 486
Length of database: 488
Length adjustment: 34
Effective length of query: 452
Effective length of database: 454
Effective search space:   205208
Effective search space used:   205208
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory