Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 2 (characterized)
to candidate GFF3909 PGA1_65p00120 putative amino-acid ABC transporter, permease protein
Query= reanno::pseudo3_N2E3:AO353_16285 (248 letters) >FitnessBrowser__Phaeo:GFF3909 Length = 224 Score = 112 bits (279), Expect = 8e-30 Identities = 67/203 (33%), Positives = 116/203 (57%), Gaps = 10/203 (4%) Query: 32 TIAIAIVAWIIALMLGSVLGVMRTVPNRLVSGIATCYVELFRNVPLLVQLFIWYFLVPDL 91 T+ +A+VA ++AL+L S+L V R + ++ + ++ FR PLLVQLF++Y+ +P + Sbjct: 23 TLFMAVVAMVLALVLASLLAVERVLRIPVLDQLVVLFISFFRGTPLLVQLFLFYYGLPQV 82 Query: 92 LPQNLQDWYKQDLNPTTSAYLSVVVCLGLFTAARVCEQVRTGIQALPRGQESAARAMGFK 151 L Q +N ++A + L L AA + E +R I + R Q AA+++G Sbjct: 83 LSVLTQ------INGVSAAIMG----LTLHFAAYMAESIRAAILGVDRSQWEAAQSIGMT 132 Query: 152 LPQIYWNVLLPQAYRIVIPPLTSEFLNVFKNSSVASLIGLMELLAQTKQTAEFSANLFEA 211 Q+ ++LPQA RI P L + F+++ K +S+A +G+ E++ T++ A S FEA Sbjct: 133 RGQMMRRIVLPQAARIAAPTLVNYFIDMIKGTSLAFTLGVTEMMGATQKEAAGSFLYFEA 192 Query: 212 FTLATLIYFTLNMSLMLLMRMVE 234 F + +IY+ L +L L+ R +E Sbjct: 193 FLVVAVIYWILVEALSLVQRRLE 215 Lambda K H 0.326 0.139 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 224 Length adjustment: 23 Effective length of query: 225 Effective length of database: 201 Effective search space: 45225 Effective search space used: 45225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory