Align GlpP, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate GFF1647 PGA1_c16700 binding protein-dependent transport system, inner membrane component
Query= TCDB::G3LHZ0 (288 letters) >FitnessBrowser__Phaeo:GFF1647 Length = 316 Score = 116 bits (291), Expect = 6e-31 Identities = 83/276 (30%), Positives = 134/276 (48%), Gaps = 10/276 (3%) Query: 11 FLVL-PVLLLVAFSAVIPLMTVVNYSVQDTFGNNEFF--WAGTDWFVQTLHSDRFWESLQ 67 FL L P++LL+ +IPL+ ++YS Q N F W G + + + +FW +L+ Sbjct: 34 FLYLSPMILLIGSVMLIPLIVGISYSFQSIELLNPFATGWVGFENYEKLWSDRKFWIALE 93 Query: 68 RNLLFSFIILALEIPLGIFIALNMPKSGPGVPVCLVLMALPLLIPWNVVGTIWQVFGRVD 127 ++F + + LG+ +A+ + G + L+ LP +P + W Sbjct: 94 NTFFWTFWSIFFQFFLGLGLAMLLNTQFFGKKLFQALVFLPWAVPTFLSALTWAWLFNPV 153 Query: 128 IGLLGHTLEAIGL---DYNYVRDPIDAWVTVIVMDVWHWTSLVVLLCYAGLVSIPDAYYQ 184 IG + H L A+G+ YN + DP A I ++W + A L SIP Y+ Sbjct: 154 IGPIPHWLAALGVLSEPYNILGDPDLAIWGPITANIWFGVPFFAITLLAALQSIPGELYE 213 Query: 185 AAKIDGASRWSVFRYIQLPKMKRVLLIAVLLRFMDSFMIYTEPFVVTGGGPGNSTTFLSI 244 AA+IDGA+ W F I LP + ++ I V+LR + FV+TGGGP NST LS Sbjct: 214 AAEIDGATPWQSFTKITLPFLAPMIAITVMLRTIWIANFADLIFVMTGGGPANSTQILST 273 Query: 245 DLVKMAVGQFDLGPAAAMSIIYFLIIL----LLSWV 276 + A + D G A+ +++ +I+L +L W+ Sbjct: 274 YIFTTAFRKLDFGYASTIAVALLIILLAYAVILLWM 309 Lambda K H 0.329 0.143 0.464 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 316 Length adjustment: 27 Effective length of query: 261 Effective length of database: 289 Effective search space: 75429 Effective search space used: 75429 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory