Align GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate GFF2690 PGA1_c27320 putative sugar ABC transporter, ATP-binding protein
Query= TCDB::G3LHY8 (358 letters) >FitnessBrowser__Phaeo:GFF2690 Length = 349 Score = 194 bits (492), Expect = 4e-54 Identities = 118/344 (34%), Positives = 175/344 (50%), Gaps = 8/344 (2%) Query: 2 LELRNAAKMVGADYHIYPTDLVLERGTLNVLLGPTLAGKTSLMRLMAGLDRPTGGSIHFD 61 +ELRN +K G+ + DL + VLLGP+ GKT+ MR++AGL+ + G I D Sbjct: 4 IELRNISKRWGSFVGVDNFDLTIADKEFLVLLGPSGCGKTTTMRMIAGLESASEGDILVD 63 Query: 62 GTDVTGMPVQKRNVAMVYQQFINYPALTVYNNIASPMRISGKDAATIDREVRKAAELLKL 121 G V + + R+VAMV+Q + YP + VY NI P+++ G DA T D +VR+A+ +++L Sbjct: 64 GNRVNELEPKDRDVAMVFQSYALYPNMNVYENIRFPLKVRGVDAKTHDEKVRRASAMVEL 123 Query: 122 TPYLDRTPLNLSGGQQQRTALARALVKNASLVLMDEPLANLDYKLREELREELPKIFAQS 181 +L R P LSGGQ+QR ALARA+V+ ++ LMDEPL+NLD KLR R ++ + + Sbjct: 124 DEFLHRKPAELSGGQRQRVALARAIVREPNVFLMDEPLSNLDAKLRVSTRAQIKNLSHEL 183 Query: 182 GAIFVYATTEPSEALLLGGNTATLNQGRVTQFGPTIEVYRRPVNLATAGIFADPPLNTLD 241 +Y T + EA+ L +N+G V Q G E+Y RP N A P +N ++ Sbjct: 184 AVTTIYVTHDQIEAMTLADRVVVMNKGVVQQVGSPTEIYDRPANAFVASFIGSPAMNLME 243 Query: 242 VTKSGNVFTRPSGVTIPVPSHLAVVPDGPVTIAFHPHHLGLAPQTGDAARLQARTLVSEI 301 SG FT + DGPVT+ F + G ++ A E+ Sbjct: 244 GGLSGGRFTAQHTDIAGLSGQ-----DGPVTLGFRAEDASVVDSGG---QINAPIYTMEL 295 Query: 302 TGSESFVHLEYDGVRWVMLAHGIHDIDPDMEVEAFLDTRHLMAF 345 G + V + GV + A + D V + T H F Sbjct: 296 LGDATMVTVRIGGVLVSVKADKTFRAEIDDMVSIHVPTDHCHLF 339 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 349 Length adjustment: 29 Effective length of query: 329 Effective length of database: 320 Effective search space: 105280 Effective search space used: 105280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory