Align GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate GFF510 PGA1_c05220 putative sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= TCDB::G3LHY8 (358 letters) >FitnessBrowser__Phaeo:GFF510 Length = 372 Score = 331 bits (849), Expect = 2e-95 Identities = 173/356 (48%), Positives = 231/356 (64%), Gaps = 4/356 (1%) Query: 2 LELRNAAKMVGADYHIYPTDLVLERGTLNVLLGPTLAGKTSLMRLMAGLDRPTGGSIHFD 61 LEL N K VGA HI T LVLE G NVLLG T +GKTSL+++MAGLD G + D Sbjct: 17 LELINVTKRVGAQLHIKETSLVLEPGHFNVLLGATGSGKTSLIKMMAGLDPIASGQVVMD 76 Query: 62 GTDVTGMPVQKRNVAMVYQQFINYPALTVYNNIASPMRISGKDAATIDREVRKAAELLKL 121 G DVT + QKRN+++V+Q FINYP +TVY NIASP++++G + I+ V +AA++L+L Sbjct: 77 GQDVTALSTQKRNISLVHQFFINYPHMTVYENIASPLKVAGMAKSEIEGRVEEAADILQL 136 Query: 122 TPYLDRTPLNLSGGQQQRTALARALVKNASLVLMDEPLANLDYKLREELREELPKIFAQS 181 P L R P LSGGQQQRTALARA+ K + V +DEPLANLDYKLREELR++LP++FA Sbjct: 137 RPMLHRRPHELSGGQQQRTALARAIAKESRAVFLDEPLANLDYKLREELRDQLPELFAGR 196 Query: 182 GAIFVYATTEPSEALLLGGNTATLNQGRVTQFGPTIEVYRRPVNLATAGIFADPPLNTLD 241 GA+ VYAT+EP EALLLGG TA + GRVTQFG T ++YR P N+A A +F+DPP+NT Sbjct: 197 GAVVVYATSEPEEALLLGGKTALMQDGRVTQFGTTADIYRNPDNVAAARVFSDPPINTAP 256 Query: 242 VTKSGNVFTRPSGVTIPVPSHLAVVPDGPVTIAFHPHHLGLAPQTGDAARLQARTLVSEI 301 + K G+ V+ + A + DGP TIA P+H+ +L + V+E+ Sbjct: 257 IVKQGSTARLGPDVSWSLTGAAADLADGPYTIAIRPYHVLPVATPLTTVQLSGQVQVTEL 316 Query: 302 TGSESFVH----LEYDGVRWVMLAHGIHDIDPDMEVEAFLDTRHLMAFGSDGRAIA 353 +GSES H L+ D WV L+ G+H + + + ++D F DG +A Sbjct: 317 SGSESSAHFDMGLDMDHGSWVSLSAGVHPYEVGEQHDFYMDPSAAYVFAPDGSRVA 372 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 372 Length adjustment: 30 Effective length of query: 328 Effective length of database: 342 Effective search space: 112176 Effective search space used: 112176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory