Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate GFF262 PGA1_c02740 sn-glycerol-3-phosphate import ATP-binding protein UgbC
Query= TCDB::G3LHY9 (356 letters) >FitnessBrowser__Phaeo:GFF262 Length = 348 Score = 226 bits (575), Expect = 9e-64 Identities = 125/348 (35%), Positives = 206/348 (59%), Gaps = 10/348 (2%) Query: 1 MARITLDHIRHAYGANPKSDKDYSLKEVDHEWNDGGAYALLGPSGCGKTTLLNIISGLLQ 60 MA++TL+ +R Y ++ S K D E+ L+GPSGCGK+TLL +I+GL Sbjct: 1 MAQVTLNSVRKVYPNGVEAVTSSSFKIEDGEF-----VVLVGPSGCGKSTLLRMIAGLED 55 Query: 61 PSHGRILFDGKDVTNLSTQSRNIAQVFQFPVIYDTMTVYDNLAFPLRNRGVAEADVDRRV 120 + G + + V N+ R+IA VFQ +Y MTV N+A+ L+NR EA++ ++V Sbjct: 56 ITEGTLEIGDRVVNNVDPADRDIAMVFQNYALYPHMTVRKNIAYGLKNRKTPEAEIKQKV 115 Query: 121 RDILEMIDLASWARRKAQGLTADQKQKISLGRGLVRNDVNAILFDEPLTVIDPHMKWVLR 180 + +M++L + RK L+ Q+Q++++GR +VR D LFDEPL+ +D ++ +R Sbjct: 116 AEAAKMLNLEEYLDRKPSQLSGGQRQRVAMGRAIVR-DPALFLFDEPLSNLDAKLRNQMR 174 Query: 181 SQLKRLHKQFGFTMVYVTHDQTEALTFAEKVVVMYDGQIVQIGTPAELFERPSHTFVGYF 240 ++K L ++ G T +YVTHDQ EA+T A++++V+ G+I QIGTP+E++ P+ FV F Sbjct: 175 IEIKALQRRLGVTSIYVTHDQVEAMTMADRIIVLNGGRIEQIGTPSEIYHNPASVFVASF 234 Query: 241 IGSPGMNFMPARIEGSTVKVGDETLTLEYAPKTSGTAKTELGIRPEFIRLGRE-GMPITI 299 +G+P MN + A I V + D A TS +LGIRPE ++L E G+ I + Sbjct: 235 MGAPPMNLLDATIANGQVTLPDGVSM--GALDTSAQGAVKLGIRPEDVQLVAEGGLAIDV 292 Query: 300 SKVEDIGRQKIVRARFADQPIAIVVPEDADI-PADARVTFDPSAISIY 346 +E++G +++ + QP I V +D + P +++ DP+AI ++ Sbjct: 293 ELIEELGAHRLLHGKLGGQPFTIHVLKDIPVDPGTHQISVDPAAICLF 340 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 348 Length adjustment: 29 Effective length of query: 327 Effective length of database: 319 Effective search space: 104313 Effective search space used: 104313 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory