Align ABC transporter for L-Histidine, periplasmic substrate-binding component 1 (characterized)
to candidate GFF3908 PGA1_65p00110 putative amino-acid ABC transporter, periplasmic solute-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2555 (249 letters) >FitnessBrowser__Phaeo:GFF3908 Length = 258 Score = 101 bits (251), Expect = 2e-26 Identities = 75/239 (31%), Positives = 121/239 (50%), Gaps = 7/239 (2%) Query: 10 ASLAAAAFCTTGAQAQDNVLRVGTDATFPPMEFVENGKRTGFDIELVEAIAKTMGKQVEW 69 A++AA+ A A D LRVG + P FV GF+++++ A+A+ G +VE+ Sbjct: 9 AAVAASLTAAPSAFASDT-LRVGMSGGYFPFTFVRQDVLQGFEVDVMNAVAEETGLEVEF 67 Query: 70 VDIDFKGLIPGLISKRFDMAVSAIYITDERKKVVDFTDSYYAGGLVVMVKADNK-AINKL 128 V + F GLI L S R D + I IT ER FT +Y G V+VK N+ +I Sbjct: 68 VTMSFSGLIGALESDRIDTIANQITITPERSAKFAFTQAYVIDGAQVVVKRGNEDSIAGP 127 Query: 129 ADLDGKKVSVQVGTKSVSYLTEKFPKVQRVEVEKNQ-EMFNLVDIGRADAAVTGKPAAFQ 187 ADL GK V+V +G+ + L + P+ ++E++ + + +GR DA V + ++ Q Sbjct: 128 ADLAGKTVAVNLGS-NFEQLLRELPQADKIEIKTYEANIAQDTALGRVDAFVMDRVSSAQ 186 Query: 188 YVRTRP-GLRVLDEQLTTEEYGMALRK--DTPELTKAVNGAITKLKADGTYAAIVKKWF 243 ++ P L + + + R+ D+ L V+ A+T L+ G A I +KWF Sbjct: 187 LIQESPLPLALAGAPFSEIRNALPFRQGADSLALRDRVDTALTTLREGGKLAEISQKWF 245 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 102 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 258 Length adjustment: 24 Effective length of query: 225 Effective length of database: 234 Effective search space: 52650 Effective search space used: 52650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory