Align Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale)
to candidate GFF3834 PGA1_262p02380 putative histidine transport system permease protein HisM
Query= uniprot:B2TBJ8 (250 letters) >FitnessBrowser__Phaeo:GFF3834 Length = 258 Score = 125 bits (315), Expect = 6e-34 Identities = 72/207 (34%), Positives = 114/207 (55%), Gaps = 4/207 (1%) Query: 21 TTLGLFFCSLILGGLLSLVIVTMRVSPHWLPNRFARAYILVFRGSPLLIQMFLVYYGMG- 79 TT+ + + ILG L++ + + W + AR + V RG+PLL+Q++L+YYG+G Sbjct: 48 TTIWILVVTSILGFALAVPLGLAQAVGPWYLSTPARIFCTVIRGTPLLLQIWLLYYGLGS 107 Query: 80 ---QFGVIRESFLWPVLREPYMCAVLSLALCTAGYTAEIIRGGLMAVPVGQIEAGYSIGL 136 QF IR S LWP LR+ + AVL+L L AGY E++RG V GQ+EA + G+ Sbjct: 108 LFPQFPWIRSSELWPYLRQAWPYAVLALTLSYAGYEGEVMRGAFSGVAKGQLEAAKAYGM 167 Query: 137 SGFALLRRVIGPIALRQCLPAYSTEAVLLVKSTALASLVTVWEVTGVAQQIIQQTYRTTE 196 + RR+ P A+R LP E +L +K+T L + +TV ++ V+ ++ T+ E Sbjct: 168 PRLTMFRRIWLPQAVRNVLPTLGGETILQLKATPLVATITVLDIYAVSSRVRSDTFIVYE 227 Query: 197 VFICAALIYLFLNFVIVRLLGMLETRL 223 + AL+Y+ + VI E R+ Sbjct: 228 PLLLLALVYMAIAGVITLAFKRFEDRV 254 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 258 Length adjustment: 24 Effective length of query: 226 Effective length of database: 234 Effective search space: 52884 Effective search space used: 52884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory