Align ABC transporter related (characterized, see rationale)
to candidate GFF3831 PGA1_262p02350 histidine transport ATP-binding protein HisP
Query= uniprot:B2TBJ9 (263 letters) >FitnessBrowser__Phaeo:GFF3831 Length = 281 Score = 303 bits (775), Expect = 3e-87 Identities = 152/253 (60%), Positives = 194/253 (76%), Gaps = 4/253 (1%) Query: 4 TAPVALSVKNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDG 63 T A+ V ++HKSFG VLKG+SL A QGDV++I+G SGSGKST LRC+N LETP+ G Sbjct: 31 TQAEAIRVCDLHKSFGSLEVLKGVSLTAKQGDVVAIIGGSGSGKSTMLRCINFLETPNSG 90 Query: 64 SVSLAGEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRV 123 + +AGE + M++ G P+DRRQ++R+R++L MVFQ FNLW+H T+LEN+IE P+ V Sbjct: 91 EIVIAGETVAMRQDGS----PADRRQIERIRTRLAMVFQQFNLWTHRTLLENVIEVPVHV 146 Query: 124 QKRSRAESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTS 183 K R+E++ A LLA+VGL +K +PA LSGGQQQR AIARALA+ P VMLFDEPTS Sbjct: 147 LKVPRSEAIHRAHELLARVGLGDKADAFPAFLSGGQQQRAAIARALAVDPNVMLFDEPTS 206 Query: 184 ALDPELVGEVLRVMRSLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVFV 243 ALDPELVGEVL V+R LA EGRTML+VTHEM FAR V+N V++L +G++E G P EVF Sbjct: 207 ALDPELVGEVLTVIRDLAAEGRTMLLVTHEMKFAREVANHVVYLFEGRIEEQGPPSEVFG 266 Query: 244 ECKSDRFRQFVSS 256 KS+R +QF+SS Sbjct: 267 NPKSERLKQFLSS 279 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 281 Length adjustment: 25 Effective length of query: 238 Effective length of database: 256 Effective search space: 60928 Effective search space used: 60928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory