Align N-formylglutamate deformylase (EC 3.5.1.68) (characterized)
to candidate GFF3578 PGA1_c36330 N-formylglutamate deformylase HutG
Query= reanno::Phaeo:GFF3578 (261 letters) >FitnessBrowser__Phaeo:GFF3578 Length = 261 Score = 553 bits (1425), Expect = e-162 Identities = 261/261 (100%), Positives = 261/261 (100%) Query: 1 MIEVTQGASPLVLGLPHTGTDVPPEVWACLNETGRALADTDWHIHDLYAGLAEGITTVRT 60 MIEVTQGASPLVLGLPHTGTDVPPEVWACLNETGRALADTDWHIHDLYAGLAEGITTVRT Sbjct: 1 MIEVTQGASPLVLGLPHTGTDVPPEVWACLNETGRALADTDWHIHDLYAGLAEGITTVRT 60 Query: 61 PVHRYVIDVNRDPGGISLYPGQNTTTLVPLTDFDGLPIWQEGKEPNEAEITRRRDAYHAP 120 PVHRYVIDVNRDPGGISLYPGQNTTTLVPLTDFDGLPIWQEGKEPNEAEITRRRDAYHAP Sbjct: 61 PVHRYVIDVNRDPGGISLYPGQNTTTLVPLTDFDGLPIWQEGKEPNEAEITRRRDAYHAP 120 Query: 121 YHAALMAELERVKAIHGFAILYDCHSIRGDIPFLFEGRLPDFNTGTNMGTTCDPEIEALT 180 YHAALMAELERVKAIHGFAILYDCHSIRGDIPFLFEGRLPDFNTGTNMGTTCDPEIEALT Sbjct: 121 YHAALMAELERVKAIHGFAILYDCHSIRGDIPFLFEGRLPDFNTGTNMGTTCDPEIEALT 180 Query: 181 VAHCEAAEGYTSTLNGRFKGGWTTRHYGRPADGLHAIQMELAQATYCQESPPWTYLPERA 240 VAHCEAAEGYTSTLNGRFKGGWTTRHYGRPADGLHAIQMELAQATYCQESPPWTYLPERA Sbjct: 181 VAHCEAAEGYTSTLNGRFKGGWTTRHYGRPADGLHAIQMELAQATYCQESPPWTYLPERA 240 Query: 241 EQLRAPLTNILTDLKNWRPSA 261 EQLRAPLTNILTDLKNWRPSA Sbjct: 241 EQLRAPLTNILTDLKNWRPSA 261 Lambda K H 0.319 0.137 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 261 Length adjustment: 25 Effective length of query: 236 Effective length of database: 236 Effective search space: 55696 Effective search space used: 55696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate GFF3578 PGA1_c36330 (N-formylglutamate deformylase HutG)
to HMM TIGR02017 (hutG: N-formylglutamate deformylase (EC 3.5.1.68))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02017.hmm # target sequence database: /tmp/gapView.8758.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02017 [M=263] Accession: TIGR02017 Description: hutG_amidohyd: N-formylglutamate deformylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-113 362.7 0.0 6.1e-113 362.6 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF3578 PGA1_c36330 N-formylglutamate de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF3578 PGA1_c36330 N-formylglutamate deformylase HutG # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 362.6 0.0 6.1e-113 6.1e-113 3 260 .. 2 257 .. 1 260 [. 0.98 Alignments for each domain: == domain 1 score: 362.6 bits; conditional E-value: 6.1e-113 TIGR02017 3 levqrGkaPllislPhtGtdltdavesrlvsaakalkdtdWhieklydfardlGatvvraaisrlvidvnrdpsga 78 +ev++G +Pl+++lPhtGtd++++v++ l+++ +al+dtdWhi+ ly+++ + G t+vr+ ++r+vidvnrdp g lcl|FitnessBrowser__Phaeo:GFF3578 2 IEVTQGASPLVLGLPHTGTDVPPEVWACLNETGRALADTDWHIHDLYAGLAE-GITTVRTPVHRYVIDVNRDPGGI 76 6899*********************************************998.59********************* PP TIGR02017 79 slypgqattgliPettfdgeplykdGeaPseaeikkrltkyfkPyhaalraeierlralhgkivlydahsirsviP 154 slypgq+tt+l+P t+fdg p++++G++P+eaei++r++ y+ Pyhaal ae+er++a+hg ++lyd+hsir iP lcl|FitnessBrowser__Phaeo:GFF3578 77 SLYPGQNTTTLVPLTDFDGLPIWQEGKEPNEAEITRRRDAYHAPYHAALMAELERVKAIHGFAILYDCHSIRGDIP 152 **************************************************************************** PP TIGR02017 155 rlfeGklPdfnlGtndgkscdpaladaveavcakakglssvlnGrfkGGyitrhygqPqngvhavqlelaqrgyle 230 +lfeG+lPdfn Gtn+g +cdp +++ +a c+ a+g++s lnGrfkGG++trhyg+P++g+ha+q+elaq +y + lcl|FitnessBrowser__Phaeo:GFF3578 153 FLFEGRLPDFNTGTNMGTTCDPEIEALTVAHCEAAEGYTSTLNGRFKGGWTTRHYGRPADGLHAIQMELAQATYCQ 228 **************************************************************************** PP TIGR02017 231 eetePvaydeakaealravlkellealldf 260 e+ P +y +++ae+lra l ++l+ l ++ lcl|FitnessBrowser__Phaeo:GFF3578 229 -ESPPWTYLPERAEQLRAPLTNILTDLKNW 257 .9***********************99988 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (261 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.85 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory