GapMind for catabolism of small carbon sources

 

Aligments for a candidate for dddA in Phaeobacter inhibens BS107

Align 3-hydroxypropionate dehydrogenase (EC 1.1.1.59) (characterized)
to candidate GFF3617 PGA1_262p00210 alcohol dehydrogenase AlkJ

Query= metacyc::MONOMER-15202
         (579 letters)



>lcl|FitnessBrowser__Phaeo:GFF3617 PGA1_262p00210 alcohol
           dehydrogenase AlkJ
          Length = 552

 Score =  324 bits (830), Expect = 7e-93
 Identities = 201/552 (36%), Positives = 294/552 (53%), Gaps = 29/552 (5%)

Query: 36  FDYIVVGAGTAGCLLANRLSADPANRVLLIEAGGRDNYHWIHIPVGYLYCINNPRTDWRF 95
           FDYI++GAG+AGC+LA+RLS    ++VL++EAGGR    WI +P+GY     +P  +W++
Sbjct: 20  FDYIIIGAGSAGCVLADRLSRSGRHKVLILEAGGRGRSPWIALPLGYGKTFFDPAVNWKY 79

Query: 96  RTEPDPGLNGRSLIYPRGKTLGGCSSINGMLYLRGQARDYDGWAELTGDDAWRWDNCLPD 155
            +  +  L GR+  +PRGK +GG  +IN ++Y RG  +D+D W E  G   W W +    
Sbjct: 80  ESVREEALAGRAGYWPRGKGVGGSGAINALVYARGLPQDFDDW-EAAGAIGWGWTSVRQG 138

Query: 156 FMRHEDHYRLDEGGDADPDHYKFHGHGGEWRIEKQRLKWQV---LADFATAAVEAGVPRT 212
           +   E            PD  +     G   +  Q +  Q+      F  AA E G+PRT
Sbjct: 139 YEAMET--------QVAPDGQR----RGSGPLHVQDVSDQIHPANRHFFAAAAELGLPRT 186

Query: 213 RDFNRGDNEGVDAFEVNQRSGWRWNASKAFLRGVEQRGNLTVWHSTQVLKLDFASGEGSE 272
            D N    EG  A+ +N   G R ++++AFL    +R N+T+     V ++ F   EG  
Sbjct: 187 DDINDPGGEGATAYRINTSGGRRMHSARAFLTPALKRKNVTLMTDALVERITF---EGR- 242

Query: 273 PRCCGVTVERAGKKVVTTARCEVVLSAGAIGSPQLLQLSGIGPTALLAEHAIPVVADLPG 332
            R   V V R GK +   A  E+VLSAGA+ SP LLQ SGIGP  LL  H I +V D P 
Sbjct: 243 -RAVSVQVRRRGKSMSIAAGREIVLSAGAVASPGLLQKSGIGPAELLRRHGIAIVDDQPQ 301

Query: 333 VGENLQDHLQIRSIYKVKGAKTLNTMANSLIGKAKIGLEYILKRSGPMSMAPSQLCIFTR 392
           VG NLQDHL I   ++     TLN + + L GK +  L Y L R GP++++ +Q   + R
Sbjct: 302 VGGNLQDHLGINYYFRAT-EPTLNNVLSPLTGKIRAALHYALWRRGPLALSVNQCGGYFR 360

Query: 393 SSKEYEHPNLEYHVQPLSLEAFGQPLHD------FPAITASVCNLNPTSRGTVRIKSGNP 446
           S++    P+ + +  P++     +   +      F           PTSRG + I S + 
Sbjct: 361 SAQSLTRPDQQLYFNPVTYTTTPEGTREVIRPDPFAGFILGFQPSRPTSRGRIDICSADV 420

Query: 447 RQAPAISPNYLSTEEDRQVAADSLRVTRHIASQPAFAKYDPEEFKPGVQYQSDEDLARLA 506
             AP I PN L+TEEDR       R+ + +A+ PA            ++  +D D+    
Sbjct: 421 SAAPLIRPNSLATEEDRSQVIAGGRLCQRLATTPALDGLIEVAMGTDLRQMADADILSDF 480

Query: 507 GDIGTTIFHPVGTAKMGRDDDPMAVVDSHLRVRGVTGLRVVDASIMPTITSGNTNSPTLM 566
            +   T+FHPVGT +MG D    +VV   L++ G+ G+RVVDAS+ P ITSGNTN+PT+M
Sbjct: 481 RERCGTVFHPVGTCRMGTDAS-TSVVCPKLKLHGLDGVRVVDASVFPNITSGNTNAPTMM 539

Query: 567 IAEKAAGWILKS 578
           +A +AA  IL++
Sbjct: 540 LAHRAADLILEA 551


Lambda     K      H
   0.318    0.135    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 860
Number of extensions: 50
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 579
Length of database: 552
Length adjustment: 36
Effective length of query: 543
Effective length of database: 516
Effective search space:   280188
Effective search space used:   280188
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory