GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ech in Phaeobacter inhibens BS107

Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate GFF2242 PGA1_c22740 fatty acid oxidation complex subunit alpha

Query= BRENDA::P07896
         (722 letters)



>lcl|FitnessBrowser__Phaeo:GFF2242 PGA1_c22740 fatty acid oxidation
           complex subunit alpha
          Length = 706

 Score =  457 bits (1175), Expect = e-132
 Identities = 277/687 (40%), Positives = 404/687 (58%), Gaps = 38/687 (5%)

Query: 11  LAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGF--SA 68
           +A I L  P VNA+   + + + + + +  +D  VKAIV+C A   FC GADI  F   A
Sbjct: 10  VAFIELNAPSVNALGLKMRQVLSSAIHELDADEQVKAIVLCSALPLFCGGADIVEFRTGA 69

Query: 69  FTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGI 128
                 L  L   I+  +KP++AAI G A+GG LE+AL C YR+A   A +GLPE+ LG+
Sbjct: 70  VWDKPDLPDLCVMIETSKKPIIAAIAGPAMGGALEIALACDYRVATPDAVMGLPEIKLGL 129

Query: 129 LPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEA--IKFAQK 186
           LPGA GTQ LPR+ G+  A  +I SG  +  + AL  G++DA+ ++D    A  + FA +
Sbjct: 130 LPGAGGTQRLPRIAGLEAATQMILSGDPVKGEYALSCGLVDALFENDQDFRAHVLGFATR 189

Query: 187 IIDKPIEPRRIFNKPV--PSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPY 244
           +  +    R   +  V  P      + F + IA   K    ++APE C+ SI+A+ + P 
Sbjct: 190 VSHEGDPKRSCADMTVRHPDPKGYLTGFRDQIAHTSKN---LVAPERCLVSIEAACEMPL 246

Query: 245 EVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGL 304
             G+++E+  F  L  + Q++A ++ FFAE+   K    + A       + ++SV V+G 
Sbjct: 247 AEGLEQEKAGFAELLDTPQSRAGRHLFFAERECTKVPGVTRAD----RPRDIASVAVIGA 302

Query: 305 GTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRF 364
           GTMGRGIAI+F + G  V  +E+    L+   + +     +   RA Q G+ SA      
Sbjct: 303 GTMGRGIAIAFLQAGYPVTLLETTQGALEQGLEKV----REHFQRAAQKGRLSADRAEAI 358

Query: 365 SS------STKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIA 418
           S+      S   L+  DL++EA FE MN+K+++F  L    KPGA L +NTS L++D+IA
Sbjct: 359 SANATGTLSYAGLAKADLIIEAAFESMNVKRQIFEALDLHAKPGAILASNTSTLDLDEIA 418

Query: 419 SSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGF 478
           + T RP+ VIG HFFSPA+VMRLLEV+    ++P  IAT ++++KKI K+ V VG CYGF
Sbjct: 419 TVTSRPEDVIGLHFFSPANVMRLLEVVRGAKTAPDVIATAITVAKKIRKLPVTVGVCYGF 478

Query: 479 VGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGL 538
           VGNRML PY+ +G  LL EG+ P+ VD VLE FG  MG   ++DLAG+DVG ++R+ +  
Sbjct: 479 VGNRMLEPYFREGSRLLLEGATPKQVDDVLEGFGMAMGIHAMADLAGVDVGARVRQERRS 538

Query: 539 TGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTF 598
                P            Y  + D L E GR GQKTG+G Y Y+   GR    DP +   
Sbjct: 539 EIAHDP-----------TYQAVQDRLFELGRLGQKTGRGSYVYE---GRTRVEDPEMVQI 584

Query: 599 LSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRH 658
            S+  ++H +++R I  +EILERCL+ LINE F ILEEG+A RP   D+I+++GYG+P  
Sbjct: 585 SSELADLHGVKRRDIDDQEILERCLFPLINEGFLILEEGIATRPGDCDLIWVNGYGFPNW 644

Query: 659 KGGPMFYAASVGLPTVLEKLQKYYRQN 685
           +GGPM YA  +GL  ++E++  +YRQ+
Sbjct: 645 RGGPMHYADEIGLSQIMERM-THYRQS 670


Lambda     K      H
   0.319    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1184
Number of extensions: 53
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 722
Length of database: 706
Length adjustment: 39
Effective length of query: 683
Effective length of database: 667
Effective search space:   455561
Effective search space used:   455561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory