Align 3-ketoacyl-CoA thiolase (EC 2.3.1.16) (characterized)
to candidate GFF3267 PGA1_c33180 acetyl-CoA acetyltransferase
Query= reanno::acidovorax_3H11:Ac3H11_2994 (397 letters) >FitnessBrowser__Phaeo:GFF3267 Length = 390 Score = 487 bits (1253), Expect = e-142 Identities = 247/387 (63%), Positives = 292/387 (75%), Gaps = 2/387 (0%) Query: 9 IVIVGAARTPMGSLQGDFSSLAAHDLGGAAIKAAIERAGVSPDAVGEVLFGNCLMAGQGQ 68 +VI GAARTPMG QG + +AA +LGG+AI+AA+ AG + V E+L G L AGQGQ Sbjct: 4 VVIAGAARTPMGGFQGMYDGVAAAELGGSAIRAALAGAGAT--TVDEILMGCVLPAGQGQ 61 Query: 69 APARQAAFKGGLPKGAGAVTLSKMCGSGMKAAMMAHDMLLAGSHDVMVAGGMESMTNAPY 128 APARQA F GL + A TL+KMCGSGMKAAMMA+D + G D M+AGGMESMTNAPY Sbjct: 62 APARQAGFAAGLGEEVPATTLNKMCGSGMKAAMMAYDQIALGQADTMIAGGMESMTNAPY 121 Query: 129 LLQKGRGGYRLGHDRIFDHMMLDGLEDAYEAGRSMGTFGEDCAAKYSFTREQQDAFATAS 188 LL K R G RLGH ++ DHM LDGLEDAY+ GR MGTF EDCA Y FTRE QD +A S Sbjct: 122 LLPKMRNGARLGHGQVVDHMFLDGLEDAYDKGRLMGTFAEDCAETYQFTREAQDEYALTS 181 Query: 189 VQRAKAATESGAFAAEIVPVTVKTRAGETVVSVDEGPGKVKLEKIATLKPAFKKDGTITA 248 + A AA ESGAF AEI PVTVKTR GETV + DE P + +KI TLKPAF+KDGT+TA Sbjct: 182 LSNALAAQESGAFDAEIAPVTVKTRKGETVTNADEQPKSARPDKIPTLKPAFRKDGTVTA 241 Query: 249 ASSSSINDGAAALVMMRESTAKKLGAKPLARIVSHATHAQEPEWFATAPLGATQKALAKA 308 A++SSI+DGAAALV+ E A+ G ARI+ HA+HAQ P F TAP+ A +K +A+ Sbjct: 242 ANASSISDGAAALVLASEDAAEAQGLTVRARIMGHASHAQAPGLFTTAPVPAAKKLMAQL 301 Query: 309 GWQVGDVQLWEINEAFAVVPMALMKELDLPHDKVNVNGGACALGHPIGASGARIMVTLIH 368 GW V DV LWE+NEAFAVVPMA M E+ LP DKVNVNGGACALGHPIGASGARIMVTL++ Sbjct: 302 GWTVSDVDLWEVNEAFAVVPMAFMHEMGLPRDKVNVNGGACALGHPIGASGARIMVTLLN 361 Query: 369 ALKARGLTKGLATLCIGGGEATAVALE 395 AL+ R L +G+A +CIGGGE TA+A+E Sbjct: 362 ALEKRNLKRGIAAICIGGGEGTAIAIE 388 Lambda K H 0.317 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 510 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 390 Length adjustment: 31 Effective length of query: 366 Effective length of database: 359 Effective search space: 131394 Effective search space used: 131394 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate GFF3267 PGA1_c33180 (acetyl-CoA acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.1849662.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-129 416.4 10.6 6.1e-129 416.2 10.6 1.0 1 lcl|FitnessBrowser__Phaeo:GFF3267 PGA1_c33180 acetyl-CoA acetyltra Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF3267 PGA1_c33180 acetyl-CoA acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 416.2 10.6 6.1e-129 6.1e-129 1 385 [] 6 388 .. 6 388 .. 0.96 Alignments for each domain: == domain 1 score: 416.2 bits; conditional E-value: 6.1e-129 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaReaalaaglpesvpa 76 i +a+Rtp+g ++g + + a++L+ +i+++l+ ag +de+ +G+vl+ag+++++aR+a +aagl+e+vpa lcl|FitnessBrowser__Phaeo:GFF3267 6 IAGAARTPMGGFQGMYDGVAAAELGGSAIRAALAGAGA--TTVDEILMGCVLPAGQGQAPARQAGFAAGLGEEVPA 79 7899******99*********************99855..58********************************** PP TIGR01930 77 ltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakledqllkdl....vktk 148 +t+n++C+Sg++A ++a+++i+ G+ad+++aGG+Esm+++p+ll++ r++++lg+ ++ d++ d+ +++ lcl|FitnessBrowser__Phaeo:GFF3267 80 TTLNKMCGSGMKAAMMAYDQIALGQADTMIAGGMESMTNAPYLLPKM--RNGARLGHGQVVDHMFLDGledaYDKG 153 *********************************************97..899999999999999988889988899 PP TIGR01930 149 lsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk..kkvvskDegirpnttlekLak 222 mg+ Ae +a++y+++Re qDeyal S ++a +A+e+g f++ei pv+vk++ ++v++ De+++ +k+ + lcl|FitnessBrowser__Phaeo:GFF3267 154 RLMGTFAEDCAETYQFTREAQDEYALTSLSNALAAQESGAFDAEIAPVTVKTRkgETVTNADEQPK-SARPDKIPT 228 9**************************************************999766667777776.899****** PP TIGR01930 223 LkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplarivsaavagvdpeemglgpvpAiekaLkkag 298 Lkpaf++ +g tvtA+N+s+++DGAaal+l+se++a++ glt+ ari+++a + p ++++pvpA +k++++ g lcl|FitnessBrowser__Phaeo:GFF3267 229 LKPAFRK-DG-TVTAANASSISDGAAALVLASEDAAEAQGLTVRARIMGHASHAQAPGLFTTAPVPAAKKLMAQLG 302 *****95.9*.6**************************************************************** PP TIGR01930 299 lsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCv 374 +++sd+dl+E+nEAFA++ +a+++e+g l ++kvNvnGGA AlGHP+GasGari++tll++L++r+ k+G+a++C+ lcl|FitnessBrowser__Phaeo:GFF3267 303 WTVSDVDLWEVNEAFAVVPMAFMHEMG-LPRDKVNVNGGACALGHPIGASGARIMVTLLNALEKRNLKRGIAAICI 377 ***************************.88********************************************** PP TIGR01930 375 ggGqGaAvile 385 ggG G+A+ +e lcl|FitnessBrowser__Phaeo:GFF3267 378 GGGEGTAIAIE 388 *******9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (390 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 19.57 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory