Align subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized)
to candidate GFF398 PGA1_c04090 beta-ketoadipyl-CoA thiolase PaaJ
Query= metacyc::MONOMER-3207 (400 letters) >FitnessBrowser__Phaeo:GFF398 Length = 400 Score = 533 bits (1374), Expect = e-156 Identities = 267/399 (66%), Positives = 314/399 (78%), Gaps = 1/399 (0%) Query: 3 DVFICDAIRTPIGRFGGALAGVRADDLAAVPLKALIEPNPAVQWDQVDEVFFGCANQAGE 62 D FICDA RTPIGR+GGAL+ +R DDLAA+P+ AL NP V W +D+V G ANQAGE Sbjct: 2 DAFICDATRTPIGRYGGALSQLRTDDLAALPIAALAARNPDVDWSSLDDVILGDANQAGE 61 Query: 63 DNRNVARMALLLAGLPESIPGVTLNRLCASGMDAIGTAFRAIASGEMELAIAGGVESMSR 122 NRNVARMA LLAGLP ++PG T+NRLCASGMDA+G A R I +G+ ++AIAGGVESMSR Sbjct: 62 SNRNVARMAALLAGLPTTVPGTTINRLCASGMDAVGMASRGIKAGDYDMAIAGGVESMSR 121 Query: 123 APFVMGKAESGYSRNMKLEDTTIGWRFINPLMKSQYGVDSMPETADNVADDYQVSRADQD 182 APFVM KA S ++R + DTTIGWRF+N M YG DSMP+TADNVA+DY +SR DQD Sbjct: 122 APFVMPKATSAFTRANAVYDTTIGWRFVNKKMHEMYGTDSMPQTADNVAEDYGISREDQD 181 Query: 183 AFALRSQQKAAAAQAAGFFAEEIVPVRIAHKKG-ETIVERDEHLRPETTLEALTKLKPVN 241 AFA RSQ + AAA AG F +EI PV I +KG + +V+ DEH RP T+ E L LK VN Sbjct: 182 AFAARSQARWAAAHEAGIFNDEITPVTIPQRKGDDLVVDTDEHPRPGTSAEKLAGLKGVN 241 Query: 242 GPDKTVTAGNASGVNDGAAALILASAEAVKKHGLTPRARVLGMASGGVAPRVMGIGPVPA 301 GPDK+VTAGNASGVNDGAAA+++A+ A K+GL P AR++GM + GV PR+MGIGPVPA Sbjct: 242 GPDKSVTAGNASGVNDGAAAILMANEAAAAKNGLKPMARIVGMTAAGVEPRIMGIGPVPA 301 Query: 302 VRKLTERLGVAVSDFDVIELNEAFASQGLAVLRELGVADDAPQVNPNGGAIALGHPLGMS 361 RK+ R G+ + DVIELNEAFASQGLA LRELGVADDAP VNPNGGAIALGHPLGMS Sbjct: 302 TRKVLARTGLTIDQMDVIELNEAFASQGLATLRELGVADDAPHVNPNGGAIALGHPLGMS 361 Query: 362 GARLVLTALHQLEKSGGRKGLATMCVGVGQGLALAIERV 400 GARLVLTA +QL+++GGR L TMCVGVGQG AL +ERV Sbjct: 362 GARLVLTAAYQLQRTGGRYALCTMCVGVGQGTALILERV 400 Lambda K H 0.318 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 541 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 400 Length adjustment: 31 Effective length of query: 369 Effective length of database: 369 Effective search space: 136161 Effective search space used: 136161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate GFF398 PGA1_c04090 (beta-ketoadipyl-CoA thiolase PaaJ)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.24948.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-139 448.7 3.7 9.7e-139 448.5 3.7 1.0 1 lcl|FitnessBrowser__Phaeo:GFF398 PGA1_c04090 beta-ketoadipyl-CoA Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF398 PGA1_c04090 beta-ketoadipyl-CoA thiolase PaaJ # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 448.5 3.7 9.7e-139 9.7e-139 1 385 [] 5 398 .. 5 398 .. 0.95 Alignments for each domain: == domain 1 score: 448.5 bits; conditional E-value: 9.7e-139 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikellera.gldpekidevilGnvlqageq.aniaReaalaaglpesvp 75 i da+Rtpig++gg+l++l+ +dL+a i +l +r+ ++d + +d+vilG + qage n+aR+aal aglp++vp lcl|FitnessBrowser__Phaeo:GFF398 5 ICDATRTPIGRYGGALSQLRTDDLAALPIAALAARNpDVDWSSLDDVILGDANQAGESnRNVARMAALLAGLPTTVP 81 789*******99**********************************************9****************** PP TIGR01930 76 altvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakledqllkdl........ 144 ++t+nr+CaSg++Av +a + ikaG++d+++aGGvEsmSr+p+++++++ s+ ++++ ++d+++ + lcl|FitnessBrowser__Phaeo:GFF398 82 GTTINRLCASGMDAVGMASRGIKAGDYDMAIAGGVESMSRAPFVMPKAT---SAFTRANAVYDTTI--Gwrfvnkkm 153 ********************************************99973...33344444444332..133567777 PP TIGR01930 145 ..vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk...kkvvskDegirpntt 216 + sm +tA+n+a++ygisRe+qD++a+rS+ + a+A+e+g f+dei+pv+++++ + vv++De++rp+t+ lcl|FitnessBrowser__Phaeo:GFF398 154 heMYGTDSMPQTADNVAEDYGISREDQDAFAARSQARWAAAHEAGIFNDEITPVTIPQRkgdDLVVDTDEHPRPGTS 230 9878889**************************************************999*999************* PP TIGR01930 217 lekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplarivsaavagvdpeemglgpvpAieka 293 +ekLa+Lk + + + s vtAgN+s++nDGAaa+l+++e++a++ gl+p+ariv+++ agv+p++mg+gpvpA++k+ lcl|FitnessBrowser__Phaeo:GFF398 231 AEKLAGLKGVNGP-DKS-VTAGNASGVNDGAAAILMANEAAAAKNGLKPMARIVGMTAAGVEPRIMGIGPVPATRKV 305 ***********95.786.*********************************************************** PP TIGR01930 294 LkkaglsisdidlvEinEAFAaqvlavekelgsld.lekvNvnGGAiAlGHPlGasGarivltllkeLkergkkyGl 369 L+++gl+i+++d++E+nEAFA+q la +elg d vN nGGAiAlGHPlG+sGar+vlt +++L++ g++y+l lcl|FitnessBrowser__Phaeo:GFF398 306 LARTGLTIDQMDVIELNEAFASQGLATLRELGVADdAPHVNPNGGAIALGHPLGMSGARLVLTAAYQLQRTGGRYAL 382 ********************************866689*************************************** PP TIGR01930 370 atlCvggGqGaAvile 385 t+Cvg GqG+A+ile lcl|FitnessBrowser__Phaeo:GFF398 383 CTMCVGVGQGTALILE 398 **************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (400 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.88 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory