Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate GFF3147 PGA1_c31980 short chain dehydrogenase
Query= metacyc::MONOMER-11802 (255 letters) >FitnessBrowser__Phaeo:GFF3147 Length = 253 Score = 98.6 bits (244), Expect = 1e-25 Identities = 82/259 (31%), Positives = 118/259 (45%), Gaps = 21/259 (8%) Query: 1 MHIANKHFIVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKAREL-----GDNARF 55 M +A K IV+G ASG GA + GA+VM+ D+NA A A A ++ D A Sbjct: 1 MRLAGKCAIVTGGASGFGAGIVTKFLTEGARVMIADINADAAAAAASDVCETYGPDRAIA 60 Query: 56 AVADISDEQAAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNL 115 D+SD + AA++ FG + LVN AG+ L F +V+ VN+ Sbjct: 61 QTVDVSDRASVDQMAQAALNHFGQIDILVNNAGVSHLPTPLEDVSEE---DFDRVVAVNM 117 Query: 116 IGSFNLLRLAAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPA 175 + R M +S + G I+N AS A + Y ASKG + + T Sbjct: 118 KSVYLTARALVPHM------KSRQSGAILNVASTAGVSPRPNLNWYNASKGWMITATRTM 171 Query: 176 ARELARFGIRVMTIAPGIFETPM----MAGMSDEVRASLAAGVPFPPRLGRPQEYAALAR 231 A ELA G+RV I P ETP+ M + EVRA + +P R P++ A Sbjct: 172 AVELAPAGVRVNAINPVAGETPLLKTFMGEDTPEVRAKFLSTIPI-GRFSTPEDMGNAAC 230 Query: 232 HII--ENSMLNGEVIRLDG 248 ++ E SM+ G + +DG Sbjct: 231 YLCSDEASMVTGVALEVDG 249 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 253 Length adjustment: 24 Effective length of query: 231 Effective length of database: 229 Effective search space: 52899 Effective search space used: 52899 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory