Align methylmalonyl-CoA mutase (subunit 1/2) (EC 5.4.99.2) (characterized)
to candidate GFF373 PGA1_c03840 methylmalonyl-CoA mutase large subunit
Query= BRENDA::A4YIE3 (155 letters) >FitnessBrowser__Phaeo:GFF373 Length = 655 Score = 115 bits (289), Expect = 1e-30 Identities = 53/114 (46%), Positives = 82/114 (71%) Query: 17 MDKRIKVVVAKLGLDGHDRGAKVIARALKDAGMEVVYTGLRQTPEQIVRTAIQEDADVIG 76 + +R+K +V K GLDGH GA+ IA +D GM++ Y G+R TPE++V +AI +DA V+G Sbjct: 518 LGRRLKFLVGKPGLDGHSNGAEQIAFRARDCGMDITYDGIRMTPEELVASAIADDAHVVG 577 Query: 77 ISILSGAHLELMPKIVEALKKAGLDDVGLVLGGVIPPEDIPKLKAMGVDDVFLP 130 +SILSG+HL L+ +++ + +AGL V +++GG+IP +D +LK MGV V+ P Sbjct: 578 MSILSGSHLPLIEELMGRMTEAGLSHVPVIVGGIIPDDDADRLKKMGVARVYTP 631 Lambda K H 0.319 0.140 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 155 Length of database: 655 Length adjustment: 27 Effective length of query: 128 Effective length of database: 628 Effective search space: 80384 Effective search space used: 80384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory