GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pco in Phaeobacter inhibens BS107

Align acyl-CoA oxidase (EC 1.3.3.6) (characterized)
to candidate GFF1551 PGA1_c15710 acyl-CoA dehydrogenase

Query= BRENDA::Q96329
         (436 letters)



>lcl|FitnessBrowser__Phaeo:GFF1551 PGA1_c15710 acyl-CoA
           dehydrogenase
          Length = 406

 Score =  224 bits (570), Expect = 5e-63
 Identities = 131/384 (34%), Positives = 204/384 (53%), Gaps = 2/384 (0%)

Query: 47  DYYHFNDLLTPEEQAIRKKVRECMEKEVAPIMTEYWEKAEFPFHITPKLGAMGVAGGSI- 105
           D    +D L+ +E+ I    R   ++++ P +   +E  E    I  ++G MG+ G +I 
Sbjct: 22  DPLRLDDQLSEDERMIAASARSYAQEKLQPRVLNAYENEETDPEIFREMGEMGLLGTTIP 81

Query: 106 KGYGCPGLSITANAIATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLAQ 165
           + YG  G    +  +   E+ RVD+   + + V SSL M  I   GSE Q++KYLP L+ 
Sbjct: 82  EQYGGLGAGYVSYGLVAREVERVDSGYRSMMSVQSSLVMYPIYAYGSEEQRQKYLPKLSS 141

Query: 166 LNTVACWALTEPDNGSDASGLGTTATKVEGGWKINGQKRWIGNSTFADLLIIFARNTTTN 225
              + C+ LTEPD GSD +G+ T A K +GG+++ G K WI N+  AD+ +++A++    
Sbjct: 142 GEWIGCFGLTEPDAGSDPAGMKTRAEKTDGGYRLTGSKMWISNAPIADVFVVWAKSEAHG 201

Query: 226 -QINGFIVKKDAPGLKATKIPNKIGLRMVQNGDILLQNVFVPDEDRLPGVNSFQDTSKVL 284
            +I GF+++K   GL A KI NK  LR    G+I++  V V D+  LP V   +     L
Sbjct: 202 GKIRGFVLEKGMKGLSAPKIANKASLRASITGEIVMDGVEVGDDALLPHVEGLKGPFGCL 261

Query: 285 AVSRVMVAWQPIGISMGIYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLGNVQAMFLMG 344
             +R  ++W  +G +   +    +Y  +RKQFG PLA  QL Q KL  M   +       
Sbjct: 262 NRARYGISWGAMGAAEACWHAARQYGLDRKQFGRPLANTQLFQLKLANMQTEITLGLQAS 321

Query: 345 WRLCKLYETGQMTPGQASLGKAWISSKARETASLGRELLGGNGILADFLVAKAFCDLEPI 404
            R+ +L +     P   S+ K     KA E A   R++ GGNGI  +F V +   +LE +
Sbjct: 322 LRVGRLMDEANAAPEMISIVKRNNCGKALEIARHARDMHGGNGISLEFGVIRHMVNLETV 381

Query: 405 YTYEGTYDINTLVTGREVTGIASF 428
            TYEGT+D++ L+ GR  TG+ +F
Sbjct: 382 NTYEGTHDVHALILGRAQTGLQAF 405


Lambda     K      H
   0.319    0.133    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 335
Number of extensions: 19
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 436
Length of database: 406
Length adjustment: 32
Effective length of query: 404
Effective length of database: 374
Effective search space:   151096
Effective search space used:   151096
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory