Align Putative sugar lactone lactonase; EC 3.1.1.- (characterized, see rationale)
to candidate GFF719 PGA1_c07340 Gluconolactonase
Query= uniprot:Q92RN9 (294 letters) >FitnessBrowser__Phaeo:GFF719 Length = 290 Score = 197 bits (500), Expect = 3e-55 Identities = 114/281 (40%), Positives = 150/281 (53%), Gaps = 9/281 (3%) Query: 10 RTLSEAASELGEGPTFDPGTGTAWWFNITGRELHELHLESGRKAIHPLPFLGSVLAVIDP 69 + SE LGEGP + P +WF+I + L L + G++ I S +D Sbjct: 13 QVFSETRCTLGEGPLWHPTRRQLFWFDILEKRL--LSVAGGKEIIWQFDDCVSAAGWVDE 70 Query: 70 LRQLIASDQGLFVRDTESSKLGHFATLE-EKPGNRSNDGRIHPCGALWIGTMGRSAEKHA 128 ++AS + L+ D ES H LE ++P RSNDGR P G WIGTMG +AE Sbjct: 71 TTLIMASARALWRFDIESGARTHLIDLEADQPLTRSNDGRADPWGGFWIGTMGYNAEFGL 130 Query: 129 GAIYHVAGSRVTKLYSNITIPNAICFSPDGATAYFTDTDVNQLMRVDIDPATALPTGDPV 188 GAIY + +L +N TI NAICF+PD + AYFTDT ++MR + P G P Sbjct: 131 GAIYRYYQGELRQLVANQTITNAICFAPDKSCAYFTDTKTGKIMRQPLAAEDGWPIGAPS 190 Query: 189 LLSDESTSPGGVDGAVCDADGLIWNARWGASAVEVYKPDGQKVARYAVPATQPSCPAFVG 248 + D S G DGA+ DA+G WNA+WGAS V VY P G+ Y+VP Q SCPA G Sbjct: 191 VFIDLSGEDFGPDGAIVDAEGRFWNAQWGASRVAVYTPTGELTEIYSVPTAQASCPALGG 250 Query: 249 AKAERLLVTSAWQGMDDAARAADPHAGKTFELGIEVKGRFE 289 A L +T+A G+D DP AGKT+ + KG+ E Sbjct: 251 ASLSYLFITTAADGLD------DPAAGKTYSIQTTAKGQRE 285 Lambda K H 0.317 0.135 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 290 Length adjustment: 26 Effective length of query: 268 Effective length of database: 264 Effective search space: 70752 Effective search space used: 70752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory