Align Sugar ABC transporter substrate-binding protein (characterized, see rationale)
to candidate GFF3852 PGA1_78p00160 putative sugar-binding periplasmic protein
Query= uniprot:A0A165KPY4 (416 letters) >FitnessBrowser__Phaeo:GFF3852 Length = 409 Score = 235 bits (600), Expect = 2e-66 Identities = 141/411 (34%), Positives = 219/411 (53%), Gaps = 13/411 (3%) Query: 3 KMTKIAAVAVGLAAAMSASAGEVEVLHYWTSGGEAKSVAELKKIMQGKG-HTWRDFAVAG 61 K+T I +A A + ++EV H+WTSGGEA +V + + G+ H W D A+AG Sbjct: 2 KLTSILMTTALSVSATIAQSADLEVTHWWTSGGEAAAVTKFADAVNGQTTHNWVDGAIAG 61 Query: 62 GGGDSAMTVLKSRVISGNPPSAAQ-TKGPAIQEWASEGVLANMDTLAKAEKWDELL-PKV 119 G +A ++ SR++ G+P +A Q T G +E G++ ++ LA+ E W +++ P Sbjct: 62 SG-TTARPIIISRILGGDPMAATQLTHGRQAEELIEAGLMTDLTELAEQEGWRDIVNPPS 120 Query: 120 VADVMKYKGAYVAAPVNVHRVNWMWGSSEALKKAGVAAMPKTWDEFFAAADKLKAAGLVP 179 + D Y+G PVN+H W+W S EA KAG++ +P+ W EF AAA KL AG+VP Sbjct: 121 LLDSCTYEGRIYCVPVNIHSTQWLWLSHEAFDKAGMS-VPQDWYEFVAAAPKLAEAGIVP 179 Query: 180 VAHGGQNWQDFTTFESVVLGVGGAKFYQDALVKLDNTALTSDTMKKSLETFRRIKGYTDP 239 +A G Q WQ F ++ +G+ ++ ++ D K + + Sbjct: 180 LAMGQQGWQQRIAFGALTVGLVDQDSWRKVSLERDAGVAAGPQYAKVFDAVVDARELAR- 238 Query: 240 GAPGRDWNLATAMLIQGKAGFQLMGDWAKGEFLAAGKAPGKDFLCAAAPGSANAFTFNVD 299 + +DWNLAT M+I GKAG Q+MGDWA+GEF A + G+D+ C G + D Sbjct: 239 NSNVQDWNLATNMVITGKAGGQIMGDWAQGEFTLAEQVAGQDYSCLPGMGLNQIIDTSGD 298 Query: 300 SFILFKLKDAAAQKAQSDLASSIMSPAFQEVFNLNKGSIPVRAGQPMDKFDDCAKASAKD 359 +F + DA ++AQ D+AS ++S Q FNL KGS+PVR + +DC K Sbjct: 299 AFYFPVIDDAEVRQAQMDMASVLISKEVQVDFNLTKGSLPVRGDVDLSAANDCMKKGLAI 358 Query: 360 FVDTAKSGGLVPSAAHGMAIAPATEGAIKDVVSQFWNDDKVSVADAMKKIA 410 D G ++PS A + T+ I+D++++FW D ++ ADA + A Sbjct: 359 LAD----GNVLPSM--DQAFSADTQAQIQDLMAEFWASD-MAAADAQARYA 402 Lambda K H 0.315 0.128 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 469 Number of extensions: 22 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 409 Length adjustment: 31 Effective length of query: 385 Effective length of database: 378 Effective search space: 145530 Effective search space used: 145530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory