Align Sugar ABC transporter permease (characterized, see rationale)
to candidate GFF1916 PGA1_c19480 ABC transporter, inner-membrane protein
Query= uniprot:A0A165KQ00 (289 letters) >FitnessBrowser__Phaeo:GFF1916 Length = 297 Score = 285 bits (729), Expect = 9e-82 Identities = 128/280 (45%), Positives = 194/280 (69%) Query: 10 SVGRFLVYAVLALATAFFLLPLYAMLVTSFKYAEEIRSTSLLALPGSLNWSAWGTAWQSA 69 S+ R +Y L++A AFFL+P+Y ++VTS K EIR ++L P + + AW AW +A Sbjct: 18 SMRRIAIYVFLSVAAAFFLMPIYIVIVTSLKTMPEIRLGNVLQWPQTWSVDAWIKAWDTA 77 Query: 70 CTGVDCNGLRPFFMNSVAMAVPAVLISTVWGALNGYVLSLWKFRGSDALFGMLLFGVFMP 129 CTG+ C G++ F NS+ + +P++++S GAL GY+L+ W FRG++ F +LLFG F+P Sbjct: 78 CTGLQCEGIKVGFWNSMRILLPSLVVSITAGALCGYILTFWTFRGAEIFFAILLFGAFVP 137 Query: 130 FQVVLLPMSQVLGWLGLSSSITGLVLVHCLAGLAGTTLFFRNYYAAIPKELVNAARMDGA 189 +Q ++ PM ++ GL ++ G+VLVH + GL TL FRNYY+ +P E+ AAR+DGA Sbjct: 138 YQALIFPMIRIFSATGLYGTLPGIVLVHTIFGLPIMTLIFRNYYSTLPSEIFKAARVDGA 197 Query: 190 SFFQIFWRIVLPLSTPIVMVTLIWQFTNIWNDFLFGVVFSGTDSKPVTVGLNNLANTSSS 249 FF +FW ++LP+STPI++V I Q T IWND+L G++F G ++ P+TV LNN+ N+ Sbjct: 198 GFFSVFWYVLLPISTPIIVVAAILQVTGIWNDYLLGLIFGGRENMPMTVQLNNIVNSVRG 257 Query: 250 VKAYNVDMAAAIIAGLPTMVIYVLAGKFFVRGLTAGAVKG 289 K YNV+MAA ++ L + +Y ++G++FVRG+ AGAVKG Sbjct: 258 GKEYNVNMAATLLTALVPLTVYFVSGRWFVRGIAAGAVKG 297 Lambda K H 0.327 0.139 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 297 Length adjustment: 26 Effective length of query: 263 Effective length of database: 271 Effective search space: 71273 Effective search space used: 71273 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory