GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lacK in Phaeobacter inhibens BS107

Align LacK, component of Lactose porter (characterized)
to candidate GFF776 PGA1_c07900 alpha-glucoside transport ATP-binding protein AglK

Query= TCDB::Q01937
         (363 letters)



>lcl|FitnessBrowser__Phaeo:GFF776 PGA1_c07900 alpha-glucoside
           transport ATP-binding protein AglK
          Length = 363

 Score =  350 bits (897), Expect = e-101
 Identities = 187/345 (54%), Positives = 243/345 (70%), Gaps = 5/345 (1%)

Query: 1   MAEVRLTDIRKSYGS-LEVIKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDISSGE 59
           MA ++LT++ K+YG  +EV++ +NL++  GE +VFVGPSGCGKSTLLRMIAGLE IS G 
Sbjct: 1   MANLKLTNVAKTYGGGVEVLRDINLDIKQGELIVFVGPSGCGKSTLLRMIAGLERISGGT 60

Query: 60  LTIGGTVMNDVDPSKRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIERRVNAAAK 119
           L I   VMND+ P++RGIAMVFQ+YALYPHMTVR+NM FAL+ A  +KDEI+  ++ AAK
Sbjct: 61  LEIDNAVMNDIPPAQRGIAMVFQSYALYPHMTVRDNMAFALKIAKKSKDEIDAAIDRAAK 120

Query: 120 ILELDALMDRKPKALSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHMRVEIARL 179
           IL+L+  +DR PKALSGGQRQRVAIGR+IVR P V+LFDEPLSNLDA LRV  R+EIA+L
Sbjct: 121 ILQLEPYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRIEIAQL 180

Query: 180 HKEL-NATIVYVTHDQVEAMTLADKIVVMRGGIVEQVGAPLALYDDPDNMFVAGFIGSPR 238
            + + ++T++YVTHDQVEAMTLA +IVV+    + QVG PL LY  P+N FVA FIGSP 
Sbjct: 181 KEAMPDSTMIYVTHDQVEAMTLASRIVVLADKGIAQVGTPLDLYQRPENEFVAQFIGSPA 240

Query: 239 MNFLPAVVIGQAEGGQVTVALKARPDTQLTVACATPPQGGDAVTVGVRPEHFLPAGSGDT 298
           MN +P  V+  A G + TV L +  +    +   T    G AV VGVRPE  +  G+G  
Sbjct: 241 MNLIPGTVV--ATGPRTTVRLTSGEEVVAEIP-TTDADQGLAVNVGVRPEDLVEEGTGGA 297

Query: 299 QLTAHVDVVEHLGNTSYVYAHTVPGEQIIIEQEERRHGGRYGDEI 343
            + + VD+VE LG  + +Y     G+  +I +    H G  G  +
Sbjct: 298 LIDSRVDIVEALGEVTVLYIAAGEGKDPLIAKLPGIHKGLRGSSV 342


Lambda     K      H
   0.320    0.137    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 398
Number of extensions: 15
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 363
Length of database: 363
Length adjustment: 29
Effective length of query: 334
Effective length of database: 334
Effective search space:   111556
Effective search space used:   111556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory