Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate GFF1630 PGA1_c16520 putative branched-chain amino acid transporter, ATP-binding protein
Query= TCDB::P73650 (240 letters) >FitnessBrowser__Phaeo:GFF1630 Length = 229 Score = 145 bits (366), Expect = 7e-40 Identities = 90/233 (38%), Positives = 139/233 (59%), Gaps = 8/233 (3%) Query: 4 LLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEII 63 LL +K+V A Y L G+ I GE+V ++G NG GKST KTI G+L S+G + Sbjct: 3 LLSLKNVTASY-GPSQALFGVELDIGEGEVVALMGRNGMGKSTTIKTICGMLPASEGTLH 61 Query: 64 FKGENITGLGSDQIVRRGMCYVPQVCNVFGSLTVAENLDMGAFLHQGPTQTLKDRIYTMF 123 F G ++ L S +I R G+ VP+ F LTV ENL A GP + +F Sbjct: 62 FAGNDLRKLHSHKIARLGIGLVPEGRRCFAPLTVEENLRAAA--RPGPWDFAM--VADLF 117 Query: 124 PKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQIKAIN 183 P+LA+RR+Q A +LSGGE+QMLA+GRALM++P LL+LDE + L+P++ ++++A I + Sbjct: 118 PRLAERRDQTASSLSGGEQQMLAIGRALMINPRLLILDEATEGLAPVVRQEIWAAIARLK 177 Query: 184 A-TGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGELYLG 235 +G +I++V++ ++ +ADR ++ G G+ +L P + + YLG Sbjct: 178 RDSGLSILVVDKTLRELAAVADRAVIVNKGATVWTGAMDAL--TPELKDRYLG 228 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 229 Length adjustment: 23 Effective length of query: 217 Effective length of database: 206 Effective search space: 44702 Effective search space used: 44702 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory