Align Putative amino-acid binding periplasmic protein (characterized, see rationale)
to candidate GFF2620 PGA1_c26610 amino acid ABC transporter, substrate-binding protein
Query= uniprot:Q92PA9 (260 letters) >FitnessBrowser__Phaeo:GFF2620 Length = 270 Score = 99.8 bits (247), Expect = 5e-26 Identities = 77/260 (29%), Positives = 125/260 (48%), Gaps = 18/260 (6%) Query: 5 RRLAATASAAVFVLMAGVAMA---EGEKVVIGTEGAYPPFNNLE-SDGTLTGFDIDIAKA 60 + +AATA A+ A A EG +VV+ E AYPP +E S G G++ D Sbjct: 11 KTVAATAGVALLASAATAADLPDLEGREVVVSVENAYPPLQFVEPSSGKAIGWEYDAMAE 70 Query: 61 LCEEMKAECTFVTQDWDGIIPALIAKKFDAIVASMSITEERKQQVDFTNKYYNTPPAIVV 120 + E + + T WD +IPA+ ++D + ++I ++RK++VDF++KY + ++V Sbjct: 71 IAERINITVVYETTSWDAMIPAVSDGQYDMGMTGITIRDDRKEKVDFSDKYLTSQMRMIV 130 Query: 121 PKD-SPITEATAAALSGKAL-GAQGSTTH-----SNYAEAHMKESEVKLYPTADEYKLDL 173 D S +A A L GAQ TT + + +KL+ T L Sbjct: 131 AGDESRFDDAAGFAADADLLAGAQPGTTPFYVTVYDILDGDEANPRIKLFETFGAAIQAL 190 Query: 174 ANGRIDAAIDDVVVLSEWLKTEDGACCKLLGTLPIDPVINGEGAGIAIRKGDDALREKLN 233 G +D A+ D + +++ DGA K++G +P + E G KG D L +N Sbjct: 191 RTGDVDLALSDSTAANGYVQASDGA-LKIVG----EP-LGTEDFGFIFPKGSD-LVAPIN 243 Query: 234 KAIEAIRANGKYKQINEKYF 253 AI A+ A+G + +N K+F Sbjct: 244 AAIAAMEADGTLEALNTKWF 263 Lambda K H 0.315 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 270 Length adjustment: 25 Effective length of query: 235 Effective length of database: 245 Effective search space: 57575 Effective search space used: 57575 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory