Align Lysine/ornithine decarboxylase; LDC; EC 4.1.1.17; EC 4.1.1.18 (uncharacterized)
to candidate GFF1150 PGA1_c11650 putative lysine/ornithine decarboxylase
Query= curated2:O50657 (393 letters) >FitnessBrowser__Phaeo:GFF1150 Length = 383 Score = 147 bits (370), Expect = 7e-40 Identities = 108/331 (32%), Positives = 165/331 (49%), Gaps = 18/331 (5%) Query: 46 VFYAMKANPTPEILSLLAGLG-SHFDVASAGEMEILHELGVDGSQMIYANPVKDARGLKA 104 V YA+KANP P +LS L G + FDVAS EM+ + D + M Y NPV+ + A Sbjct: 47 VTYAVKANPHPAVLSNLVAAGITGFDVASPAEMDAVRAASPD-AVMHYNNPVRSDVEIAA 105 Query: 105 AADYNVRRFTFDDPSEIDKMAKAVPGADVLVRIAVRNNKALVDLNTKFGAPVEEALDLLK 164 + V ++ D+PSE+DK+A ++ VR A+ A D +KFGA + A++LLK Sbjct: 106 GIAHGVASWSVDEPSELDKLADVPKSCEIAVRFALPVAGAAYDFGSKFGAEPDMAIELLK 165 Query: 165 AAQDAGLHAMGICFHVGSQSLSTAAYEEALLVARRLFDEAEEMGMHLTDLDIGGGFPVPD 224 G +CFH G+Q +A+ E + A+R+ D A G+ + L++GGGF + Sbjct: 166 RVAAEG-WTPALCFHPGTQCEDESAWVEYVHAAKRIIDAA---GVKIARLNVGGGF-AAN 220 Query: 225 AKGLNVDLAAMMEAINKQIDRLFPD--TAVWTEPGRYMCGTAVNLVTSVIGTKTRGEQPW 282 G+ DL + AI +D F D + EPGR M + L + G + GE Sbjct: 221 RDGVAPDLEKVFAAIWVAVDAAFGDDKPGLICEPGRAMVSESFTLAARIKGIRKAGEV-- 278 Query: 283 YILDEGIYGCFSGIMYDHWTYPLHCFGK------GNKKPSTFGGPSCDGIDVLYRDFMAP 336 L++G+YG I + + +P GP+CD +D L P Sbjct: 279 VFLNDGVYGGLVDIRDMGLPGRVEVVAADGTRRGADAQPRVVFGPTCDSLDRLPDGLPLP 338 Query: 337 -ELKIGDKVLVTEMGSYTSVSATRFNGFYLA 366 + +IGD VL +G+Y+S +T+FNG+ L+ Sbjct: 339 RDTQIGDYVLFPGLGAYSSAMSTQFNGYGLS 369 Lambda K H 0.320 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 383 Length adjustment: 30 Effective length of query: 363 Effective length of database: 353 Effective search space: 128139 Effective search space used: 128139 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory