Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.109) (characterized)
to candidate GFF122 PGA1_c01240 electron transfer flavoprotein subunit alpha
Query= BRENDA::Q18AQ5 (336 letters) >FitnessBrowser__Phaeo:GFF122 Length = 308 Score = 152 bits (385), Expect = 8e-42 Identities = 98/268 (36%), Positives = 155/268 (57%), Gaps = 12/268 (4%) Query: 57 GADEVIVVDDEALAVYTTEPYTKAAYEAIKAADPIVVLFGATSIGRDLAPRVSARIHTGL 116 G +V+V +D +L EP AA A A+D ++ AT+ +++ PRV+A + + Sbjct: 53 GVAKVLVAEDASLGHRLAEP--TAALIASLASDYEHIVAPATTDAKNVLPRVAALLDVMV 110 Query: 117 TADCTGLAVAEDTKLLLMTRPAFGGNIMATIVCKDFRPQMSTVRPGVMKKNEPDETKEAV 176 +D +G+ V DT RP + GN + T+ +D + +S R + + A Sbjct: 111 ISDVSGV-VDGDT----FERPIYAGNAVQTVKSRDAKKVIS-FRTSTF--DAAGDGGSAS 162 Query: 177 INRFKVEFNDADKLVQVVQVIKEAKKQVKIEDAKILVSAGRGMGGKENLDILYELAEIIG 236 ++ N L + V+ A + ++ A ++VS GRG+G +E+ ++ LA+ +G Sbjct: 163 VDTISAAENPG--LSEWVEDKVAASDRPELTSAGVVVSGGRGVGSEEDFKLIESLADKLG 220 Query: 237 GEVSGSRATIDAGWLDKARQVGQTGKTVRPDLYIACGISGAIQHIAGMEDAEFIVAINKN 296 V SRA +D+G+ QVGQTGK V P+LY+A GISGAIQH+AGM+D++ IVAINK+ Sbjct: 221 AAVGASRAAVDSGYAPNDWQVGQTGKVVAPELYVAVGISGAIQHLAGMKDSKIIVAINKD 280 Query: 297 PEAPIFKYADVGIVGDVHKVLPELISQL 324 EAPIF+ AD G+V D+ + +PELI +L Sbjct: 281 EEAPIFQVADYGLVADLFQAVPELIEKL 308 Lambda K H 0.316 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 308 Length adjustment: 28 Effective length of query: 308 Effective length of database: 280 Effective search space: 86240 Effective search space used: 86240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory