GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fadB in Phaeobacter inhibens BS107

Align fatty acid oxidation complex subunit alpha; EC 1.1.1.35; EC 4.2.1.17; EC 5.1.2.3 (characterized)
to candidate GFF1187 PGA1_c12020 fatty acid oxidation complex FadJ subunit alpha

Query= CharProtDB::CH_003230
         (714 letters)



>lcl|FitnessBrowser__Phaeo:GFF1187 PGA1_c12020 fatty acid oxidation
           complex FadJ subunit alpha
          Length = 733

 Score =  384 bits (987), Expect = e-111
 Identities = 254/730 (34%), Positives = 372/730 (50%), Gaps = 37/730 (5%)

Query: 5   SAFTLNVRLDNIAVITIDVPGEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKPDN 64
           S FT+    D +A+IT D PG+ MN L  +    +  ++     +  ++G+V  S K D 
Sbjct: 2   SDFTMKKDADGVAIITWDCPGKTMNVLNGQAMIDLDGLVDDALADDAVKGIVITSGKKD- 60

Query: 65  FIAGADINMI-----------------GNCKTAQEAEALARQGQQLMAEIHALPIQVIAA 107
           F  G D+N++                 G  K  +    + R G          P  V AA
Sbjct: 61  FAGGMDLNVLAKMKEDAGDEPARGLFEGIMKMHEGLRKIERAGMDPKTNKGGKP--VAAA 118

Query: 108 IHGACLGGGLELALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEM 167
           + G  +G GLEL L+ H     D+PK  +GLPE+ +G+ PG+GGT RL R +G   A   
Sbjct: 119 LPGTAVGIGLELPLSTHRIFAADNPKAKIGLPEIMVGIFPGAGGTTRLVRKMGAMAAAPF 178

Query: 168 ILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKKERPSSRPLPVRERILAG-----P 222
           +L GK +  K+A   G++D+VV   +    A  L  K+    +P   +   + G     P
Sbjct: 179 LLEGKLVDPKKAKGAGIIDEVVEDPLAAARAWVLEAKDADIVKPWDAKGYKMPGGAPYHP 238

Query: 223 LGRALLFKMVGKKTEHKTQGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQS 282
            G  + F         KT G +PA + +L  V  G      +    EAR F  + M P S
Sbjct: 239 AG-FMTFLGAAAMVHGKTFGAFPAAKALLSAVYEGALVPFDTALKIEARWFTHVLMNPSS 297

Query: 283 QAL-RSIFFASTDVKKDPGSDA--PPAPLNSVGILGGGLMGGGIAYVTACKAGIPVRIKD 339
           +A+ RS+F     ++K     A      +  +G+LG G+MG GIA V+A +AG+ V + D
Sbjct: 298 EAMIRSLFLNKEALEKGAVRPAGIEDQSVKKIGVLGAGMMGAGIALVSA-QAGMEVVLID 356

Query: 340 INPQGINHALKYSWDQLEGKVRRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFEN 399
            +    +    Y+   L+  ++R  + A +++  L+ I+ T D       DLIIEAVFE+
Sbjct: 357 RDQAAADKGKAYTESYLDKGIKRGKVTADKKEAMLSRITATPDLDHLKGCDLIIEAVFED 416

Query: 400 LELKQQMVAEVEQNCAAHTIFASNTSSLPIGDIAAHATRPEQVIGLHFFSPVEKMPLVEI 459
             +K +M  +VE       IFASNTS+LPI D+A  + RPEQ IG+HFFSPVEKM LVEI
Sbjct: 417 PGVKAEMTKKVEAIIPEDCIFASNTSTLPITDLAEASVRPEQFIGIHFFSPVEKMFLVEI 476

Query: 460 IPHAGTSAQTIATTVKLAKKQGKTPIVVRDKAGFYVNRILAPYINEAIRMLTQGERVEHI 519
           I    T  + +A  +   ++  KTPIVV D   FY NR + PY+NE  RM+T+G     I
Sbjct: 477 IKGEKTGDRAVAKALDYVRQIRKTPIVVNDARFFYCNRCIIPYVNEGARMITEGVAPALI 536

Query: 520 DAALVKFGFPVGPIQLLDEVGIDTGTKIIPVLEAAYGERF--SAPANVVSSILNDDRKGR 577
           D A  + GFPVGPIQL DE  ID G KI    +AA G+ +  SA  +++  +    R GR
Sbjct: 537 DNAARQLGFPVGPIQLTDETSIDLGAKIARATKAAMGDAYPESAADDLIFWMEEQGRLGR 596

Query: 578 KNGRGFYLYGQKG-RKSKKQVDPAIYPLIGTQGQGRISAPQVAERCVMLMLNEAVRCVDE 636
           K+  GF+ Y  KG R+   +     YPL   Q        +V ER +   + EAVR ++E
Sbjct: 597 KSNAGFFDYDDKGKRQGYWKGMQEKYPLADEQP----DLIEVQERLMFAQVLEAVRALEE 652

Query: 637 QVIRSVRDGDIGAVFGIGFPPFLGGPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCERLV 696
            V+  +R+GD+GA+   GF P+ GGP  ++D +G         +L  +YG RFT    L 
Sbjct: 653 GVLMDIREGDVGAILAWGFAPWSGGPLSWLDIIGTPYAAERCDQLTAKYGERFTCPPLLR 712

Query: 697 EMGARGESFW 706
           EM  +G++F+
Sbjct: 713 EMAEKGQTFY 722


Lambda     K      H
   0.319    0.137    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1084
Number of extensions: 53
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 714
Length of database: 733
Length adjustment: 40
Effective length of query: 674
Effective length of database: 693
Effective search space:   467082
Effective search space used:   467082
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory