Align Histidine transport system permease protein HisM (characterized)
to candidate GFF1140 PGA1_c11550 putative histidine transport system permease protein
Query= SwissProt::P0A2I7 (235 letters) >FitnessBrowser__Phaeo:GFF1140 Length = 268 Score = 120 bits (302), Expect = 2e-32 Identities = 71/218 (32%), Positives = 123/218 (56%), Gaps = 9/218 (4%) Query: 21 TGVAITLWLLISSVVMGGLLAVILAVGRVSSNKFIRFPIWLFTYIFRGTPLYVQLLVFYS 80 +G+ ++ +VV+G ++A +A+ + S++ +R F +IFRG+PL++Q F++ Sbjct: 38 SGMLWNIYFGAIAVVVGFVIANGVALAKNSTSTPLRKAAEWFIFIFRGSPLFIQF--FFA 95 Query: 81 GMYTLEIVKGTDLLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYG 140 L++ + + N + + ++ L LNT AY+ EIF GA+RS+P G+IEAA AYG Sbjct: 96 YFLFLQLKSVSPIFNPLSAAWMGALIV-LILNTAAYSAEIFYGALRSIPKGDIEAADAYG 154 Query: 141 FSSFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVP------DLLKIARDINS 194 S + +R I+ P+ +R+A P+Y+NE I + H+T L F + P D L A Sbjct: 155 LSGWPRFRRIMWPTMMRLAWPSYTNEAIFLFHATTLVFFSGFPAWQQRGDALYYASYFAD 214 Query: 195 ATYQPFTAFGIAAVLYLLISYVLISLFRRAERRWLQHV 232 T+ PF + I A ++L++ V+I +F R H+ Sbjct: 215 KTFNPFVPYPILAFYFILLTLVVIGIFGIINTRLNAHL 252 Lambda K H 0.330 0.141 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 235 Length of database: 268 Length adjustment: 24 Effective length of query: 211 Effective length of database: 244 Effective search space: 51484 Effective search space used: 51484 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory