Align 3-keto-5-aminohexanoate cleavage enzyme (EC 2.3.1.247) (characterized)
to candidate GFF826 PGA1_c08400 Uncharacterized conserved protein
Query= BRENDA::Q8RHX2 (272 letters) >FitnessBrowser__Phaeo:GFF826 Length = 305 Score = 165 bits (418), Expect = 1e-45 Identities = 101/296 (34%), Positives = 156/296 (52%), Gaps = 25/296 (8%) Query: 1 MMEKLIITAAICGAEVTKEHNPAVPYTVEEIAREAESAYKAGASIIHLHVREDD-GTPTQ 59 M + + IT A+ G+ T++ +P VP + + IA A +A KAGA+I+H HVR+ + G P++ Sbjct: 5 MAKNVFITCAVTGSGSTQDRSPHVPRSPKAIAESAIAAAKAGAAIVHCHVRDPETGAPSR 64 Query: 60 DKERFRKCIEAIREKCPDVIIQPSTG--GAVGMTDLERLQP------------------T 99 D +R+ + IRE DV++ + G G + D E P Sbjct: 65 DLTLYREVTDRIRESDTDVVLNLTAGMGGDMVFGDTENPLPLNEAGTDMIGATARMAHVA 124 Query: 100 ELHPEMATLDCGTCNFG-GDEIFVNTENTIKNFGKILIERGVKPEIEVFDKGMIDYAIRY 158 E PE+ TLDCGT NF D + NT ++ G+++ + GVKPEIE FD G + +A Sbjct: 125 ECLPEICTLDCGTMNFAEADYVMTNTPGMLRAMGQMMTDLGVKPEIEAFDTGHLWFAKEL 184 Query: 159 QKQGFIQKPMHFDFVLGVQMSA--SARDLVFMSESIPEGSTWTVAGVGRHQFQMAALAIV 216 K+G + P +GV A + M ++P W+ +GR Q A +++ Sbjct: 185 VKEGVLNSPALVQLCMGVPWGAPNDLNTFMAMVNNVPSDWDWSAFSLGRDQMAYVAASVL 244 Query: 217 MGGHVRVGFEDNVYIDKGILAKSNGELVERVVRLAKELGREIATPDEARQILSLKK 272 GG+VRVG EDN+++ KG LA+ N +LVER + + +G ++ PDE R L L K Sbjct: 245 AGGNVRVGLEDNLWLGKGQLAE-NWQLVERAGTIIENMGAKLMGPDEVRAQLGLVK 299 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 10 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 305 Length adjustment: 26 Effective length of query: 246 Effective length of database: 279 Effective search space: 68634 Effective search space used: 68634 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory