GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lysN in Phaeobacter inhibens BS107

Align 2-aminoadipate transaminase (EC 2.6.1.39) (characterized)
to candidate GFF2829 PGA1_c28750 aminotransferase class-III

Query= reanno::Putida:PP_4108
         (416 letters)



>lcl|FitnessBrowser__Phaeo:GFF2829 PGA1_c28750 aminotransferase
           class-III
          Length = 440

 Score =  152 bits (385), Expect = 1e-41
 Identities = 132/422 (31%), Positives = 195/422 (46%), Gaps = 43/422 (10%)

Query: 28  DTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAPHGPYLALMEQLSQF 87
           D +GKRY+D  GG  V  LGH +  V+ A+Q Q  +L           P  AL + L   
Sbjct: 26  DANGKRYLDGSGGAAVSCLGHSDAEVIAAVQEQVGKLAFAHTGFLTSEPAEALADLLISQ 85

Query: 88  VPVSYPLAGMLTNSGAEAAENALKVAR------GATGKRAIIAFDGGFHGRTLATLNLNG 141
            P          + G+EA E A+K+AR      G T +R +IA    +HG TL  L   G
Sbjct: 86  APGDLHRV-YFVSGGSEATEAAIKLARQYHLERGDTTRRHVIARRQSYHGNTLGALAAGG 144

Query: 142 KVAPYKQRVGELPGPVYHLP--YPSADTG---VTCEQALKAMDRLFS--VELAVEDVAAF 194
             A  +Q+   L   + H+   Y   D G      +   +  + L +  + L  E V AF
Sbjct: 145 N-AWRRQQFAPLLIDISHIAPCYEYVDRGDGESRYDYGQRVANELEAEILRLGPETVMAF 203

Query: 195 IFEPVQGE-GGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAFPRLGIEPD 253
           + EPV G   G +     + + +R  CD+ G+L+I+DE+  G GRTG  FA    G+ PD
Sbjct: 204 MAEPVVGATSGAVPAVEGYFKRIREICDQYGVLLILDEVMCGMGRTGHLFACEADGVAPD 263

Query: 254 LLLLAKSI-AGGMPLGAVVGRKELMAALPKGG----LGGTYSGNPISCAAALASLAQMTD 308
           +L +AK + AG  P+GA++  +++  A+  G      G TY G+P++ AA LA +  + D
Sbjct: 264 ILCIAKGLGAGYQPIGAMLCSRQIYDAIEGGSGFFQHGHTYIGHPVATAAGLAVVRALLD 323

Query: 309 ENL----ATWGERQEQAIVSRYERWKASGLSPYIGRLTGVGAMRGIEFANADGSPAPAQ- 363
             L    A  GE    A+V+R+      G  P++G L G G  RGIE      S  P   
Sbjct: 324 RGLVQRSAEMGETLHAALVARF------GQHPHVGDLRGRGLFRGIELVADRESKTPFDP 377

Query: 364 ----LAKVMEAARARGLLLMPSGKAR------HIIRLLAPLTIEAEVLEEGLDILEQCLA 413
                 K+ +AA   GL+  P    R      HI+ L  P  +  + + E  D LE  L 
Sbjct: 378 GLGIAGKLKKAAFEAGLICYPMAGTRDGRNGDHIL-LAPPFILSEDQIGEITDKLEVALD 436

Query: 414 EL 415
           ++
Sbjct: 437 QV 438


Lambda     K      H
   0.320    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 475
Number of extensions: 24
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 416
Length of database: 440
Length adjustment: 32
Effective length of query: 384
Effective length of database: 408
Effective search space:   156672
Effective search space used:   156672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory