Align ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) (characterized)
to candidate GFF1303 PGA1_c13190 ABC transporter permease protein
Query= BRENDA::P68183 (296 letters) >FitnessBrowser__Phaeo:GFF1303 Length = 276 Score = 98.2 bits (243), Expect = 2e-25 Identities = 80/269 (29%), Positives = 127/269 (47%), Gaps = 16/269 (5%) Query: 27 IMFPLLMVVAISLRQGNFATGSLIPEQISWDHWKLALGFSVEQADGRITPPPFPVLLWLW 86 I FP+L + S + A P + W L +SV Q + +LW Sbjct: 24 IFFPILWTILTSFKTEAQAISD--PPVFLFFDWTLE-NYSVVQERS-------DYMRFLW 73 Query: 87 NSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVALYALFDR 146 NSV +AG S I + ++ A++ A + +L ML +M PAV L +Y LF + Sbjct: 74 NSVIIAGGSTILGIIIAVPAAWSMAFVPSKRTKDILLWMLSTKMLPAVGVLYPIYILFIK 133 Query: 147 LGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLV 206 +G + N G V+ L + + VW + YF+ I + EAA +DGAT + V Sbjct: 134 MG-----LLDNRFGLVVVLMLINLPIIVWMLYTYFKEIPGEILEAARMDGATLKEEILYV 188 Query: 207 LLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAA 266 L P+++P +A +L+ I A E +L L + L + Y +P+ + +AA Sbjct: 189 LTPMAIPGIASTLLLNIILAWNEA-FWTLNLTAAKAAPLTAFIASYSSPEGLFYAKLSAA 247 Query: 267 AVMSALPITIVFLLAQRWLVNGLTAGGVK 295 + M+ PI I+ +Q+ LV+GLT G VK Sbjct: 248 STMAIAPILILGWFSQKQLVSGLTFGAVK 276 Lambda K H 0.328 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 276 Length adjustment: 26 Effective length of query: 270 Effective length of database: 250 Effective search space: 67500 Effective search space used: 67500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory