Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate GFF1646 PGA1_c16690 binding protein-dependent transport system, inner membrane component
Query= uniprot:C8WUQ9 (301 letters) >FitnessBrowser__Phaeo:GFF1646 Length = 283 Score = 137 bits (345), Expect = 3e-37 Identities = 81/258 (31%), Positives = 140/258 (54%), Gaps = 10/258 (3%) Query: 50 LLPMWFVVIASFNPSNSYISFS--LFPSNASLANYKALFQGGQFWTWVRNSLVVGVVVAM 107 L P+++++ + P S + PS + N+ + +F + RNSL V + A Sbjct: 30 LFPLYWLMKIAITPDALIFSEGTRMLPSAVTFENFATVLFETEFLAYFRNSLTVSLGTAF 89 Query: 108 AQSFITAMSAFAFSKLRFYGRKYGLMTLLLLQMFPNILAIAAFYTALAKLNMIDMLGSYI 167 + I A + +AFS+ F G++ + +L+ QMFP ++ IA Y +A L +++ L S I Sbjct: 90 FTTLIAAGAGYAFSRFVFAGKRIIIAVMLITQMFPLLMIIAPIYKIVADLGLLNSLTSLI 149 Query: 168 LVMLGTSAFNI----WLLKGYMDSVPKELDEAAVIDGATTWQRFIHVTLPLSTPMMVVIF 223 +V +AFNI +L++ + D +PK+L+EAA++DG + +Q V PL+ P + Sbjct: 150 VVY---TAFNIPFATFLMQSFFDGIPKDLEEAAMMDGCSRFQALRTVVFPLTLPGLGATL 206 Query: 224 FLTLVGIFSEYMFAGTILQSPWNYTLGVGMYNLISGQFAKNWGEFAAAALLSAVPLAIVF 283 +SE +FA ++ T VG+ +S +F+ +WG+ AA +L+ VP + F Sbjct: 207 GFVFTAAWSELLFALMLISKNDAMTFPVGLLTFVS-KFSVDWGQMMAAGVLALVPSCLFF 265 Query: 284 AVAQRYLTKGLVAGSVKG 301 QRYL +GL +G+VKG Sbjct: 266 IFIQRYLVQGLTSGAVKG 283 Lambda K H 0.328 0.136 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 283 Length adjustment: 26 Effective length of query: 275 Effective length of database: 257 Effective search space: 70675 Effective search space used: 70675 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory