Align ABC-type Maltose/ Maltodextrin permease (characterized, see rationale)
to candidate GFF1646 PGA1_c16690 binding protein-dependent transport system, inner membrane component
Query= uniprot:Q6MNM1 (272 letters) >FitnessBrowser__Phaeo:GFF1646 Length = 283 Score = 193 bits (490), Expect = 4e-54 Identities = 88/265 (33%), Positives = 161/265 (60%) Query: 8 WISILLFSLFSIYPILYVLSVSLRPDNAFQTQSLEIIGPNASFKNFVDLFATTDFLIWMR 67 + +I + F+++P+ +++ +++ PD ++ ++ +F+NF + T+FL + R Sbjct: 19 YAAIAFYLGFALFPLYWLMKIAITPDALIFSEGTRMLPSAVTFENFATVLFETEFLAYFR 78 Query: 68 NSLVVSAATTLLGVALASTSAYALARYRFRGRNMMLFSLLMTQMFPATMLMLPFYIILSK 127 NSL VS T +A+ + YA +R+ F G+ +++ +L+TQMFP M++ P Y I++ Sbjct: 79 NSLTVSLGTAFFTTLIAAGAGYAFSRFVFAGKRIIIAVMLITQMFPLLMIIAPIYKIVAD 138 Query: 128 LRLIDSFWGLFLIYSSTALPFCIWQMKAYYDTIPRELEEAALLDGCSKWMIFYKIILPVS 187 L L++S L ++Y++ +PF + M++++D IP++LEEAA++DGCS++ ++ P++ Sbjct: 139 LGLLNSLTSLIVVYTAFNIPFATFLMQSFFDGIPKDLEEAAMMDGCSRFQALRTVVFPLT 198 Query: 188 SPALVITALFSFMSSWSEYVIAAVVLQDPQLYTLPLGLRSFQASLATQWGLYAAGALIVS 247 P L T F F ++WSE + A +++ T P+GL +F + + WG A ++ Sbjct: 199 LPGLGATLGFVFTAAWSELLFALMLISKNDAMTFPVGLLTFVSKFSVDWGQMMAAGVLAL 258 Query: 248 VPVLILFISISRYLVSGLTMGSVKG 272 VP + FI I RYLV GLT G+VKG Sbjct: 259 VPSCLFFIFIQRYLVQGLTSGAVKG 283 Lambda K H 0.329 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 283 Length adjustment: 25 Effective length of query: 247 Effective length of database: 258 Effective search space: 63726 Effective search space used: 63726 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory