Align ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized)
to candidate GFF2754 PGA1_c27970 ATP-binding transport protein SmoK
Query= BRENDA::P68187 (371 letters) >FitnessBrowser__Phaeo:GFF2754 Length = 331 Score = 322 bits (826), Expect = 7e-93 Identities = 184/363 (50%), Positives = 232/363 (63%), Gaps = 39/363 (10%) Query: 1 MASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDL 60 M ++QL NV K++G V V KDINL + +GEFVVFVGPSGCGKSTLLR+I+GLE T+G++ Sbjct: 1 MTALQLTNVCKSFGPVEVLKDINLTVEDGEFVVFVGPSGCGKSTLLRVISGLEDATAGEI 60 Query: 61 FIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV 120 IG + + TPPA+RG+ MVFQSYALYPHLSV ENM+ LK KE I RV + + + Sbjct: 61 SIGGQTVTTTPPAKRGIAMVFQSYALYPHLSVRENMALALKQERQPKEEIAARVAEASRM 120 Query: 121 LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLH 180 L L LDR+P LSGGQRQRVAIGR +V EP +FL DEPLSNLDAALR+ R+EI+RLH Sbjct: 121 LSLEDYLDRRPSELSGGQRQRVAIGRAVVREPKLFLFDEPLSNLDAALRMNTRLEIARLH 180 Query: 181 KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMN 240 ++L +MIYVTHDQ+EAMTLADKIVVL GR+ QVG P+ELY+ PA+RFVA FIG+P MN Sbjct: 181 RQLSASMIYVTHDQIEAMTLADKIVVLRDGRIEQVGTPMELYNNPANRFVAEFIGAPAMN 240 Query: 241 FLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGAN--MSLGIRPEHLLPSDIADV 298 F+P + ++G N +GIRPE+ S + Sbjct: 241 FVPAQ------------------------------RLGGNPGQFIGIRPEYARISPVGP- 269 Query: 299 ILEGEVQVVEQLGNETQIHIQIPS--IRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFR 356 L GEV VE+LG +T I + + ++ Q+D G T P C F Sbjct: 270 -LAGEVIHVEKLGGDTNILVDMGEDLTFTARLFGQHD---TNVGETLQFDFDPANCLSFD 325 Query: 357 EDG 359 E G Sbjct: 326 EAG 328 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 331 Length adjustment: 29 Effective length of query: 342 Effective length of database: 302 Effective search space: 103284 Effective search space used: 103284 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory