Align ABC-type maltose transport, ATP binding protein (characterized, see rationale)
to candidate GFF1915 PGA1_c19470 ABC transporter, ATP-binding protein
Query= uniprot:Q6MNM2 (347 letters) >FitnessBrowser__Phaeo:GFF1915 Length = 363 Score = 293 bits (751), Expect = 4e-84 Identities = 164/345 (47%), Positives = 225/345 (65%), Gaps = 19/345 (5%) Query: 13 FGSADVLKGIDLDIAPGEFLVLVGPSGCGKSTLLRTLAGLESADSGTISIDGKKINDIEP 72 FG+ +VLK ++LDI GEFLVL+G SGCGKSTLL T+AGL+ A G I I+ + + EP Sbjct: 22 FGAVEVLKSLNLDIQKGEFLVLLGASGCGKSTLLNTIAGLQEATEGQIWINDENVTWREP 81 Query: 73 QNRDIAMVFQSYALYPHMTVAENMGFGLKLKNLAAAEITKRVNEISELLQIKHLLDRKPK 132 ++R +AMVFQSYALYP MTV N+ FGL++ + AE K V+E + +LQ++ LLDR+P Sbjct: 82 KDRGLAMVFQSYALYPKMTVRGNLAFGLRMNKVPKAEADKLVDEAARVLQLEELLDRRPG 141 Query: 133 ELSGGQRQRVALGRALSRQTPVILFDEPLSNLDAHLRSQMRLEIKRLHHNSKSTMIYVTH 192 ELSGGQRQRVA+GRAL R+ V LFDEPLSNLDA LR+++R+E+KRLH +TMIYVTH Sbjct: 142 ELSGGQRQRVAIGRALVRKVDVFLFDEPLSNLDAKLRAELRVELKRLHQELGATMIYVTH 201 Query: 193 DQMEATTLGDRIAVLKDGVIEQIGTPSEIYHRPKNTFIATFIGSPEMNFLEGAVLEKIPW 252 DQ+EA TL DRIAV+KDGV++Q+ +P EIY RP N ++A F+G P MNF+ G V E Sbjct: 202 DQVEALTLADRIAVMKDGVVQQLDSPEEIYRRPANRYVAQFVGLPSMNFVNGVVTES--- 258 Query: 253 PEARKADQILGIRPDAFALNQGPLGTQEVAL----------GDFQIDIS--ENLGGQQML 300 + D L + A P E+ + G F +D+ E LG ++++ Sbjct: 259 GAIQTEDFELALDQCNLASTPAPGTEVEIGIRPEHVHPANAGGFMLDVGMVELLGSERLI 318 Query: 301 HGTLAGNNVRILVDSMDNFSMKQTLPLKIDLTKA--HLFDKKTGL 343 G + GN ++ D D +++ ++I+L +F KTGL Sbjct: 319 WGKV-GNTSIVMRDDPDT-TIRSGDQVRINLKPGAFSVFSAKTGL 361 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 363 Length adjustment: 29 Effective length of query: 318 Effective length of database: 334 Effective search space: 106212 Effective search space used: 106212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory