Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate GFF2690 PGA1_c27320 putative sugar ABC transporter, ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >lcl|FitnessBrowser__Phaeo:GFF2690 PGA1_c27320 putative sugar ABC transporter, ATP-binding protein Length = 349 Score = 304 bits (779), Expect = 2e-87 Identities = 174/376 (46%), Positives = 232/376 (61%), Gaps = 29/376 (7%) Query: 1 MTTLKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEG 60 M ++L NI KR+ V+NF+L I DKEF+V +GPSGCGK+TT+RMIAGLE +EG Sbjct: 1 MAQIELRNISKRW--GSFVGVDNFDLTIADKEFLVLLGPSGCGKTTTMRMIAGLESASEG 58 Query: 61 NLYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAA 120 ++ +D +N+ PKDRD+AMVFQ+YALYP+M+VYEN+ F LK+R +++V A+ Sbjct: 59 DILVDGNRVNELEPKDRDVAMVFQSYALYPNMNVYENIRFPLKVRGVDAKTHDEKVRRAS 118 Query: 121 EILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAK 180 ++ L EFL RKPA+LSGGQRQRVA+ RAIVR+ VFLMDEPLSNLDAKLRV+ RA+I Sbjct: 119 AMVELDEFLHRKPAELSGGQRQRVALARAIVREPNVFLMDEPLSNLDAKLRVSTRAQIKN 178 Query: 181 IHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANK 240 + + TTIYVTHDQ EAMTLADR+V+M+ G ++Q+G+P E+Y+ PAN Sbjct: 179 LSHELAVTTIYVTHDQIEAMTLADRVVVMNK----------GVVQQVGSPTEIYDRPANA 228 Query: 241 FVAGFIGSPAMNFFEVTVEKERLVNQDGLSLALPQGQEKILEEKGYLGKKVTLGIRPEDI 300 FVA FIGSPAMN E + R Q +A GQ+ VTLG R ED Sbjct: 229 FVASFIGSPAMNLMEGGLSGGRFTAQH-TDIAGLSGQD----------GPVTLGFRAEDA 277 Query: 301 SSDQIVHETFPNASVTADILVSELLGSESMLYVKFGSTEFTARVNARDSHSPGEKVQLTF 360 S +V + A I ELLG +M+ V+ G + + + + V + Sbjct: 278 S---VVDS---GGQINAPIYTMELLGDATMVTVRIGGVLVSVKADKTFRAEIDDMVSIHV 331 Query: 361 NIAKGHFFDLETEKRI 376 H FD +T R+ Sbjct: 332 PTDHCHLFDTQTGARL 347 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 349 Length adjustment: 29 Effective length of query: 348 Effective length of database: 320 Effective search space: 111360 Effective search space used: 111360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory