Align ABC-type sugar transport system, permease component, component of Maltose transporter, MusEFGKI (characterized)
to candidate GFF1917 PGA1_c19490 ABC transporter, inner-membrane protein
Query= TCDB::Q8NMV4 (281 letters) >FitnessBrowser__Phaeo:GFF1917 Length = 294 Score = 117 bits (294), Expect = 2e-31 Identities = 80/260 (30%), Positives = 130/260 (50%), Gaps = 17/260 (6%) Query: 20 FMIAFLVPFI--VGFF--LSFTKFTTITNAKWVGIDNYVKAFSQREGFISAFGFTVLVVI 75 F++ L+ F+ VG+ LSFT + N +VG+D Y + F +S +L + Sbjct: 19 FVVIVLLIFVGCVGWSVQLSFTNSKLLPNGDFVGLDQYYRLFRTTRWIVSLKNM-LLFGV 77 Query: 76 VSVITVNIFAFLLAWLLTRKLRGTNFFRTVFFMPNLIGGIVLGYTWQTMIN-------AV 128 V I FLLA LL +K+R FFRT+F P + +V G WQ +N AV Sbjct: 78 FFVSGALILGFLLAILLDQKIRAEAFFRTIFLYPYSLSFVVTGLAWQWFLNPSLGLQNAV 137 Query: 129 LSHYATTISADW----KFGYAGLIMLLNWQLIGYMMIIYIAGLQNVPPELIEAAELDGVN 184 ++ + DW +++ W G +M + +AGL+ V PE+ A+++DG+ Sbjct: 138 RELGWSSFTFDWLTDQSMAIYTIVIAAIWHGSGLVMALMLAGLRGVDPEIWRASKIDGIP 197 Query: 185 KWEMLRHVTIPMVMPSITICLFLTLSNSFKLFDQNLALTNGAPGGQTEMVALNIINTLFN 244 W + H+ P++ P I + L + K FD +A+TNG PG TE+ A +++ + Sbjct: 198 TWRVYVHIVAPILGPVIFASVVLLSLSVVKGFDIVVAMTNGGPGIATEVPAKFVLDHILE 257 Query: 245 RMNVEGVGQAKAVIFVVVVV 264 R NV G+ A A I ++ V+ Sbjct: 258 RANV-GLAMAGATIMLITVI 276 Lambda K H 0.331 0.142 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 294 Length adjustment: 26 Effective length of query: 255 Effective length of database: 268 Effective search space: 68340 Effective search space used: 68340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory