Align ABC-type transporter, permease components, component of Maltose transporter, MusEFGKI (characterized)
to candidate GFF2752 PGA1_c27950 ABC transporter permease protein
Query= TCDB::Q8NMV5 (304 letters) >FitnessBrowser__Phaeo:GFF2752 Length = 280 Score = 136 bits (342), Expect = 6e-37 Identities = 85/284 (29%), Positives = 154/284 (54%), Gaps = 13/284 (4%) Query: 27 HMSGSAKF---VVYAILAFFTIVFLGPILFIFINSFKSKFAISSDPFSLPIGETW--VGF 81 H S S F + + L +T++ L P+ I +NSFK++ AI DP LP +T+ VG+ Sbjct: 3 HKSRSNPFNSILAHGALITYTLIALFPVFVILVNSFKTRKAIFRDPLGLPTSDTFSLVGY 62 Query: 82 ENFMVGLTKQG-FLEATLWSFIITILSVIVIVFFSAMTAYYITRVKTWWTNLLYYLFVVS 140 + + KQG F S I+T++S+ +++ F AM A+ + + LL + Sbjct: 63 QTVL----KQGDFFLYFQNSMIVTVVSLALVLLFGAMAAFALAEYRFKGNMLLGLYLALG 118 Query: 141 MIIPFQMVMFPTVKI-ADMLHLNNPIGIVVLYLGFGSGLSVFMFAGFVKSIPLDVEEAAM 199 ++IP ++ +++ D +N ++++Y G L+VF+ + F+K + D++ A Sbjct: 119 IMIPIRIGTVAILELMVDTGLVNTLTALILVYTAQGLPLAVFILSEFMKQVSDDLKNAGR 178 Query: 200 IDGCGPLQNYFRVVWPMLKPTAITVAILNAMWVWNDYLLPYLVIGLSTRYKTIPVVIQSF 259 IDG +FR+V P+++P TVA+ N + +WND P L++ + KT+ + Q F Sbjct: 179 IDGLSEYTIFFRLVLPLVRPAMATVAVFNMIPIWNDLWFP-LILAPAEETKTLTLGSQVF 237 Query: 260 VGSNGNRDTGAMMAMLVLAIIPIVIFYFSTQRHIIEGVAAGAVK 303 +G D A+++ L +AI+P+++ Y R +I G+ +GAVK Sbjct: 238 IGQFVT-DWNAVLSALSMAILPVMVLYVIFSRQLIRGITSGAVK 280 Lambda K H 0.329 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 280 Length adjustment: 26 Effective length of query: 278 Effective length of database: 254 Effective search space: 70612 Effective search space used: 70612 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory