Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate GFF2690 PGA1_c27320 putative sugar ABC transporter, ATP-binding protein
Query= BRENDA::Q8NMV1 (376 letters) >FitnessBrowser__Phaeo:GFF2690 Length = 349 Score = 295 bits (756), Expect = 1e-84 Identities = 153/273 (56%), Positives = 193/273 (70%), Gaps = 8/273 (2%) Query: 21 VKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDGAIFIGDKDVTHVAPRDRDIA 80 V F+L IAD EFLVL+GPSGCGK+TT+RM+AGLE+ ++G I + V + P+DRD+A Sbjct: 19 VDNFDLTIADKEFLVLLGPSGCGKTTTMRMIAGLESASEGDILVDGNRVNELEPKDRDVA 78 Query: 81 MVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAAATLGLTEFLERKPKALSGGQ 140 MVFQ+YALYP+M V EN+ F LK+ G +++V A+A + L EFL RKP LSGGQ Sbjct: 79 MVFQSYALYPNMNVYENIRFPLKVRGVDAKTHDEKVRRASAMVELDEFLHRKPAELSGGQ 138 Query: 141 RQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQRKLGVTTVYVTHDQTEAL 200 RQRVA+ RAIVR P VFLMDEPLSNLDAKLRV TR QI L +L VTT+YVTHDQ EA+ Sbjct: 139 RQRVALARAIVREPNVFLMDEPLSNLDAKLRVSTRAQIKNLSHELAVTTIYVTHDQIEAM 198 Query: 201 TMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPAMNLGTFSVKDGDATSGHARI 260 T+ DR+ V+ G +QQVG+P E+YDRPAN FVA FIGSPAMNL + G T+ H I Sbjct: 199 TLADRVVVMNKGVVQQVGSPTEIYDRPANAFVASFIGSPAMNLMEGGLSGGRFTAQHTDI 258 Query: 261 KLSPETLAAMTPEDNGRITIGFRPEALEIIPEG 293 A ++ +D G +T+GFR E ++ G Sbjct: 259 -------AGLSGQD-GPVTLGFRAEDASVVDSG 283 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 349 Length adjustment: 29 Effective length of query: 347 Effective length of database: 320 Effective search space: 111040 Effective search space used: 111040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory