Align Putative maltose permease, component of MalEFG (K unknown), involved in maltose and maltodextrin uptake (characterized)
to candidate GFF1646 PGA1_c16690 binding protein-dependent transport system, inner membrane component
Query= TCDB::Q9KZ08 (303 letters) >FitnessBrowser__Phaeo:GFF1646 Length = 283 Score = 185 bits (470), Expect = 9e-52 Identities = 100/274 (36%), Positives = 158/274 (57%), Gaps = 1/274 (0%) Query: 31 RSRAASLASHGVLTLASLVALFPVAWLVYLSLGPDKNDYLHPGRIW-SKMTFDNYAFVLQ 89 R A + + + ALFP+ WL+ +++ PD + R+ S +TF+N+A VL Sbjct: 10 RHPALAFGKYAAIAFYLGFALFPLYWLMKIAITPDALIFSEGTRMLPSAVTFENFATVLF 69 Query: 90 DTNFFDWLKSSLIVSLGTTVIGVLVAATTGYAVSRMRFPGYRKLMWVLLVTQMFPIAVLI 149 +T F + ++SL VSLGT L+AA GYA SR F G R ++ V+L+TQMFP+ ++I Sbjct: 70 ETEFLAYFRNSLTVSLGTAFFTTLIAAGAGYAFSRFVFAGKRIIIAVMLITQMFPLLMII 129 Query: 150 VPMYQILSKLQLIDNYFGLILVYCSTAVPYCAWLLKGYFDTIPFEIDEAGRVDGLTPFGT 209 P+Y+I++ L L+++ LI+VY + +P+ +L++ +FD IP +++EA +DG + F Sbjct: 130 APIYKIVADLGLLNSLTSLIVVYTAFNIPFATFLMQSFFDGIPKDLEEAAMMDGCSRFQA 189 Query: 210 FFRLILPLARPGLAVAGFYSFITAFGEVAFASTFMLSDTKYTFAVGLQSFVSEHDAQRNL 269 ++ PL PGL + F A+ E+ FA + + TF VGL +FVS+ Sbjct: 190 LRTVVFPLTLPGLGATLGFVFTAAWSELLFALMLISKNDAMTFPVGLLTFVSKFSVDWGQ 249 Query: 270 MAATAVLVAIPVSAFFYLVQKNLVTGLTAGGTKG 303 M A VL +P FF +Q+ LV GLT+G KG Sbjct: 250 MMAAGVLALVPSCLFFIFIQRYLVQGLTSGAVKG 283 Lambda K H 0.326 0.139 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 283 Length adjustment: 26 Effective length of query: 277 Effective length of database: 257 Effective search space: 71189 Effective search space used: 71189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory