Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate GFF2276 PGA1_c23080 ribose transport system permease protein RbsC
Query= uniprot:D8IZC8 (344 letters) >FitnessBrowser__Phaeo:GFF2276 Length = 324 Score = 186 bits (473), Expect = 5e-52 Identities = 108/299 (36%), Positives = 166/299 (55%), Gaps = 7/299 (2%) Query: 37 VLVVLYLLFYGLTLYLSGDGTSNFASAENTMNILRQVAINLVLAAGMTFVILTAGIDLSV 96 +L+ L G T+ F + +N N++R AI V+A G+TFV+++ +DLSV Sbjct: 18 ILIAFALFIIGFTI-----ANPKFLTLDNFENVVRSSAILGVMALGVTFVVISGNLDLSV 72 Query: 97 GSVLAVSAVLGMQVSLGAAPGWAIPMFIFSGLVMGMVNGAMVALLNINAFVVTLGTMTAF 156 GS+++ S ++ + + P AIP L +G + G +V L +N+ +VTLG ++A Sbjct: 73 GSMMSFSTIVVLDLHDKLGPTLAIPAMFAMTLCLGALIGFLVGYLKLNSLIVTLGMLSAI 132 Query: 157 RGAAYLLADGTT--VLNNDIPSFEWIGNGDFLHVPWLIWVAVAVVLLSWVILRKTVLGMH 214 G + G + + + F G G+ L + I + +A+ L +IL KT G Sbjct: 133 HGLTLTYSGGKNMDIADKEGTWFAIFGQGNILGIQTPILIFIALAALLGIILAKTPFGRK 192 Query: 215 IYAIGGNLQAARLTGIRVGLVLLFVYSISGLFSGLAGAMSASRLYGANGNWGSGYELDAI 274 +YA+GGN AA +GIR V+ Y +S L AG + ASR G+ G G EL+ + Sbjct: 193 VYAVGGNGTAATFSGIRRARVVFLCYIMSALCVATAGLIQASRSMGSQNTVGQGLELEVL 252 Query: 275 AAVVLGGTSLMGGVGSIWGTVVGALIIGVMNNGLTILGLSSFWQYVAKGAVIVLAVILD 333 AAV+LGG SL+GG G+I+ TV+G LI+G + NGL ++GL QYV +I+LAV LD Sbjct: 253 AAVILGGASLLGGSGTIFKTVIGVLILGFIQNGLLLVGLDFSVQYVVTWIIIILAVWLD 311 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 324 Length adjustment: 28 Effective length of query: 316 Effective length of database: 296 Effective search space: 93536 Effective search space used: 93536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory