Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate GFF2762 PGA1_c28050 putative sugar transport system, permease protein
Query= uniprot:D8IZC8 (344 letters) >FitnessBrowser__Phaeo:GFF2762 Length = 353 Score = 179 bits (453), Expect = 1e-49 Identities = 115/319 (36%), Positives = 179/319 (56%), Gaps = 12/319 (3%) Query: 30 HRLGMLPVLVVLYLLFYGLTLYLSGDGTSNFASAENTMNILRQVAINLVLAAGMTFVILT 89 H L + P LV L +L + ++ G+ F+ T+ IL+QV I ++A + VILT Sbjct: 34 HMLHVTPSLVPLIVLVLSVIVFGLLLGSKFFSPFALTL-ILQQVGIVGIVACAQSLVILT 92 Query: 90 AGIDLSVGSVLAVSAVLGMQVSL--GAAPGWAIPMFIFSGLVMGMVNGAMVALLNINAFV 147 AGIDLSVG+++ +S+V+ Q + G P A+ + G + G +NG +VA + + F+ Sbjct: 93 AGIDLSVGAIMVLSSVVMGQFTFRYGLPPEVAVACGLICGTICGFINGWLVARMKLPPFI 152 Query: 148 VTLGTMTAFRGAAYLLADGTTVLNNDI----PSFEWIGN----GDFLHVPWLIWVAVAVV 199 VTLG + +L + T+ + I P + G G + +I++ + VV Sbjct: 153 VTLGMWQIVLASNFLYSANETIRSQTIAAEAPLLQLFGEKIKIGGAVFTYGVIFMVILVV 212 Query: 200 LLSWVILRKTVLGMHIYAIGGNLQAARLTGIRVGLVLLFVYSISGLFSGLAGAMSASRLY 259 LL++V LR T G H+YA+G + +AA L+G++V VL+ VY +SGL AG R+ Sbjct: 213 LLAYV-LRHTAWGRHVYAVGDDPEAAELSGVKVTRVLISVYMLSGLICAFAGWAMIGRIG 271 Query: 260 GANGNWGSGYELDAIAAVVLGGTSLMGGVGSIWGTVVGALIIGVMNNGLTILGLSSFWQY 319 + G +++I AVV+GG SL GG GSI GT GALI+GV GL +LG + W Y Sbjct: 272 SVSPTSGQLANIESITAVVIGGISLFGGRGSILGTFFGALIVGVFTLGLRLLGADAQWTY 331 Query: 320 VAKGAVIVLAVILDKWRQK 338 + G +I+ AV +D+W +K Sbjct: 332 LLIGLLIIAAVAVDQWIRK 350 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 353 Length adjustment: 29 Effective length of query: 315 Effective length of database: 324 Effective search space: 102060 Effective search space used: 102060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory